Model_id Action ARO_name ARO_category Changes To Summary 2079 UPDATE sgm kanamycin A; aminoglycoside antibiotic; isepamicin; gentamicin; 16S rRNA methyltransferase (G1405); sisomicin; arbekacin; gentamicin B; netilmicin; antibiotic target alteration; gentamicin C; amikacin; dibekacin; G418; tobramycin; ARO_category "UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 3856 UPDATE OXA-846 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 343 UPDATE OXA-31 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 813 UPDATE OXA-216 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3494 UPDATE OXA-409 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 816 UPDATE OXA-3 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2910 UPDATE OXA-665 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4839 UPDATE OXA-504 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2912 UPDATE OXA-274 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1260 UPDATE APH(3')-IVa antibiotic inactivation; aminoglycoside antibiotic; paromomycin; kanamycin A; APH(3'); ribostamycin; neomycin; butirosin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-phosphotransferase enzymes with modification regiospecificity based at the 3'-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics, specifically kanamycin and neomycin, by the ATP-dependent phosphorylation of the 3'-hydroxyl group of the compound. DELETED 36999 " 4969 UPDATE OXA-644 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 965 UPDATE OXA-333 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 715 UPDATE PDC-3 penam; carbapenem; cephalosporin; cefazolin; ampicillin; ceftazidime; cefalotin; cephamycin; antibiotic inactivation; PDC beta-lactamase; monobactam; cefixime; ceftriaxone; cefoxitin; ARO_category "DELETED 40951 " 967 UPDATE AAC(6')-Isa 2'-N-ethylnetilmicin; 5-episisomicin; AAC(6'); aminoglycoside antibiotic; sisomicin; antibiotic inactivation; netilmicin; amikacin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. UPDATED category_aro_name with amikacin UPDATED category_aro_cvterm_id with 35932 UPDATED category_aro_accession with 0000013 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Amikacin is an aminoglycoside antibiotic that works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with tobramycin UPDATED category_aro_cvterm_id with 35969 UPDATED category_aro_accession with 0000052 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Tobramycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Tobramycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. " 5180 UPDATE OXA-883 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1266 UPDATE ANT(4')-IIa antibiotic inactivation; isepamicin; ANT(4'); amikacin; aminoglycoside antibiotic; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-nucleotidyltransferase enzymes with modification regiospecificity based at the 4'-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics by transfer of an AMP group from an ATP substrate to the 4-hydroxyl group of the compound. DELETED 37001 " 1327 UPDATE AAC(6')-Iq 2'-N-ethylnetilmicin; 5-episisomicin; AAC(6'); aminoglycoside antibiotic; sisomicin; antibiotic inactivation; netilmicin; amikacin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. DELETED 35966 UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. " 2072 UPDATE NmcR penam; carbapenem; NmcA beta-lactamase; cefazolin; cephalosporin; antibiotic inactivation; cephamycin; ampicillin; cefoxitin; ARO_category "DELETED 35981 " 5181 UPDATE OXA-884 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1496 UPDATE OXA-224 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3334 UPDATE AAC(6')-Il 2'-N-ethylnetilmicin; 5-episisomicin; AAC(6'); aminoglycoside antibiotic; sisomicin; antibiotic inactivation; netilmicin; amikacin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. DELETED 35966 UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. " 1995 UPDATE AAC(6')-Iz 2'-N-ethylnetilmicin; 5-episisomicin; AAC(6'); aminoglycoside antibiotic; sisomicin; antibiotic inactivation; netilmicin; amikacin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. UPDATED category_aro_name with amikacin UPDATED category_aro_cvterm_id with 35932 UPDATED category_aro_accession with 0000013 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Amikacin is an aminoglycoside antibiotic that works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. " 3338 UPDATE AAC(6')-Iag 2'-N-ethylnetilmicin; 5-episisomicin; AAC(6'); aminoglycoside antibiotic; sisomicin; antibiotic inactivation; netilmicin; amikacin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. DELETED 35966 UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. " 2178 UPDATE glycopeptide resistance gene cluster VanO glycopeptide antibiotic; glycopeptide resistance gene cluster; antibiotic target alteration; vancomycin; model_description "UPDATED model_description with Gene Cluster Meta-Models (GCM) are used to curate spatial clusters of individual genes within operons, such as for glycopeptide resistance gene clusters. The individual genes will have their own individual detection models (e.g. PHM, PVM, POM, etc.) while the GCM checks to see if all the component genes of the cluster have a Strict or Perfect hit and are ordered correctly within an operon. GCMs are encoded using the gene order parameter. This model type is still under development and not currently supported by the Resistance Gene Identifier (RGI) software. " 4935 UPDATE OXA-609 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3485 UPDATE OXA-392 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1068 UPDATE AAC(6')-Ib3 antibiotic inactivation; AAC(6'); kanamycin A; amikacin; aminoglycoside antibiotic; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. " 1703 UPDATE FosK fosfomycin; fosfomycin thiol transferase; antibiotic inactivation; phosphonic acid antibiotic; ARO_category "UPDATED category_aro_name with fosfomycin UPDATED category_aro_cvterm_id with 35944 UPDATED category_aro_accession with 0000025 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Fosfomycin (also known as phosphomycin and phosphonomycin) is a broad-spectrum antibiotic produced by certain Streptomyces species. It is effective on gram positive and negative bacteria as it targets the cell wall, an essential feature shared by both bacteria. Its specific target is MurA (MurZ in E.coli), which attaches phosphoenolpyruvate (PEP) to UDP-N-acetylglucosamine, a step of commitment to cell wall synthesis. In the active site of MurA, the active cysteine molecule is alkylated which stops the catalytic reaction. " 4936 UPDATE OXA-610 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1706 UPDATE OXA-142 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1361 UPDATE OXA-223 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5232 UPDATE OXA-948 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1065 UPDATE OXA-384 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4962 UPDATE OXA-636 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4075 UPDATE OXA-499 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2184 UPDATE glycopeptide resistance gene cluster VanC glycopeptide antibiotic; glycopeptide resistance gene cluster; antibiotic target alteration; vancomycin; model_description "UPDATED model_description with Gene Cluster Meta-Models (GCM) are used to curate spatial clusters of individual genes within operons, such as for glycopeptide resistance gene clusters. The individual genes will have their own individual detection models (e.g. PHM, PVM, POM, etc.) while the GCM checks to see if all the component genes of the cluster have a Strict or Perfect hit and are ordered correctly within an operon. GCMs are encoded using the gene order parameter. This model type is still under development and not currently supported by the Resistance Gene Identifier (RGI) software. " 1258 UPDATE OXA-55 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5222 UPDATE OXA-937 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 295 UPDATE OXA-145 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5221 UPDATE OXA-935 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 291 UPDATE APH(3')-Ia antibiotic inactivation; aminoglycoside antibiotic; gentamicin; lividomycin; paromomycin; kanamycin A; APH(3'); gentamicin B; ribostamycin; neomycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-phosphotransferase enzymes with modification regiospecificity based at the 3'-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics, specifically kanamycin and neomycin, by the ATP-dependent phosphorylation of the 3'-hydroxyl group of the compound. DELETED 36997 UPDATED category_aro_name with gentamicin B UPDATED category_aro_cvterm_id with 36999 UPDATED category_aro_accession with 3000655 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin B is a semisynthetic aminoglycoside antibacterial. UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). UPDATED category_aro_name with lividomycin UPDATED category_aro_cvterm_id with 37002 UPDATED category_aro_accession with 3000658 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Lividomycins are aminoglycosidic antibiotics produced by Streptomyces lividus. They contain 2-amino-2,3-dideoxy-D-glucose. " 1128 UPDATE OXA-23 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5189 UPDATE OXA-892 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1083 UPDATE OXA-323 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1121 UPDATE APH(3')-VIa antibiotic inactivation; aminoglycoside antibiotic; isepamicin; gentamicin; paromomycin; kanamycin A; APH(3'); gentamicin B; amikacin; ribostamycin; neomycin; butirosin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-phosphotransferase enzymes with modification regiospecificity based at the 3'-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics, specifically kanamycin and neomycin, by the ATP-dependent phosphorylation of the 3'-hydroxyl group of the compound. DELETED 36997 UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 3779 UPDATE Yrc-1 penam; antibiotic inactivation; cephalosporin; cefoxitin; ceftazidime; cefalotin; cephamycin; cefuroxime; amoxicillin; YRC Beta-lactamase; ARO_category "UPDATED category_aro_name with ceftazidime UPDATED category_aro_cvterm_id with 35977 UPDATED category_aro_accession with 0000060 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Ceftazidime is a third-generation cephalosporin antibiotic. Like other third-generation cephalosporins, it has broad spectrum activity against Gram-positive and Gram-negative bacteria. Unlike most third-generation agents, it is active against Pseudomonas aeruginosa, however it has weaker activity against Gram-positive microorganisms and is not used for such infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with cephamycin UPDATED category_aro_cvterm_id with 35962 UPDATED category_aro_accession with 0000044 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Cephamycins are a group of beta-lactam antibiotics, very similar to cephalosporins. Together with cephalosporins, they form a sub-group of antibiotics known as cephems. Cephamycins are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. The 7-alpha-methoxy group increases resistance to beta-lactamases. UPDATED category_aro_name with cefuroxime UPDATED category_aro_cvterm_id with 35980 UPDATED category_aro_accession with 0000063 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefuroxime is a second-generation cephalosporin antibiotic with increased stability with beta-lactamases than first-generation cephalosporins. Cefuroxime is active against Gram-positive organisms but less active against methicillin-resistant strains. UPDATED category_aro_name with amoxicillin UPDATED category_aro_cvterm_id with 35981 UPDATED category_aro_accession with 0000064 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Amoxicillin is a moderate-spectrum, bacteriolytic, beta-lactam antibiotic used to treat bacterial infections caused by susceptible microorganisms. A derivative of penicillin, it has a wider range of treatment but remains relatively ineffective against Gram-negative bacteria. It is commonly taken with clavulanic acid, a beta-lactamase inhibitor. Like other beta-lactams, amoxicillin interferes with the synthesis of peptidoglycan. UPDATED category_aro_name with cefoxitin UPDATED category_aro_cvterm_id with 35927 UPDATED category_aro_accession with 0000008 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefoxitin is a cephamycin antibiotic often grouped with the second generation cephalosporins. Cefoxitin is bactericidal and acts by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. Cefoxitin's 7-alpha-methoxy group and 3' leaving group make it a poor substrate for most beta-lactamases. " 5084 UPDATE OXA-775 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 191 UPDATE OXA-199 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 190 UPDATE OXA-195 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1126 UPDATE OXA-184 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4070 UPDATE OXA-648 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5028 UPDATE OXA-716 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 274 UPDATE OXA-174 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5225 UPDATE OXA-940 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4072 UPDATE OXA-649 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1413 UPDATE OXA-172 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4930 UPDATE OXA-604 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3382 UPDATE aadS antibiotic inactivation; streptomycin; aminoglycoside antibiotic; ANT(6); ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-nucleotidyltransferase enzymes with modification regiospecificity based at the 6-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics, specifically streptomycin, by transfer of an AMP group from an ATP substrate to the 6-hydroxyl group of the compound. " 3381 UPDATE aadA27 antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-nucleotidyltransferase enzymes with modification regiospecificity based at the 3''-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics by transfer of an AMP group from an ATP substrate to the 3''-hydroxyl group of the compound. " 48 UPDATE OXA-90 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 922 UPDATE AAC(6')-30/AAC(6')-Ib' fusion protein antibiotic inactivation; aminoglycoside antibiotic; aminoglycoside bifunctional resistance protein; gentamicin; gentamicin A; ARO_category; model_name; ARO_name "DELETED 36484 UPDATED category_aro_name with aminoglycoside bifunctional resistance protein UPDATED category_aro_cvterm_id with 46171 UPDATED category_aro_accession with 3007419 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with Bifunctional aminoglycoside-inactivating enzymes composed of two separate functional domains. These proteins possess activity from both enzyme components, thereby conferring resistance to the combination of antibiotics from both domains, and may include acetylation, phosphorylation or nucleotidylation activity. UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). UPDATED model_name with AAC(6')-30/AAC(6')-Ib' bifunctional protein UPDATED ARO_name with AAC(6')-30/AAC(6')-Ib' bifunctional protein " 2383 UPDATE ANT(4')-Ib antibiotic inactivation; tobramycin; dibekacin; ANT(4'); amikacin; isepamicin; aminoglycoside antibiotic; ARO_description; ARO_category "UPDATED ARO_description with Aminoglycoside nucleotidyltransferase sequence from Staphylococcus aureus plasmid. UPDATED category_aro_description with A category of aminoglycoside O-nucleotidyltransferase enzymes with modification regiospecificity based at the 4'-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics by transfer of an AMP group from an ATP substrate to the 4-hydroxyl group of the compound. DELETED 37001 UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. " 1018 UPDATE APH(3')-IIc antibiotic inactivation; aminoglycoside antibiotic; gentamicin; paromomycin; kanamycin A; APH(3'); gentamicin B; ribostamycin; neomycin; butirosin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-phosphotransferase enzymes with modification regiospecificity based at the 3'-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics, specifically kanamycin and neomycin, by the ATP-dependent phosphorylation of the 3'-hydroxyl group of the compound. DELETED 36997 UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 521 UPDATE OXA-386 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 426 UPDATE aadK antibiotic inactivation; streptomycin; aminoglycoside antibiotic; ANT(6); ARO_description; ARO_category "UPDATED ARO_description with aadK is a chromosomal-encoded aminoglycoside nucleotidyltransferase gene in B. subtilis and Bacillus spp. This enzyme confers low-level resistance to streptomycin. UPDATED category_aro_description with A category of aminoglycoside O-nucleotidyltransferase enzymes with modification regiospecificity based at the 6-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics, specifically streptomycin, by transfer of an AMP group from an ATP substrate to the 6-hydroxyl group of the compound. " 523 UPDATE OXA-75 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1403 UPDATE OXA-388 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1402 UPDATE OXA-390 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1016 UPDATE OXA-255 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1406 UPDATE OXA-121 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1405 UPDATE armA kanamycin A; aminoglycoside antibiotic; isepamicin; gentamicin; 16S rRNA methyltransferase (G1405); sisomicin; arbekacin; gentamicin B; netilmicin; antibiotic target alteration; gentamicin C; amikacin; dibekacin; G418; tobramycin; ARO_category "UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 1013 UPDATE APH(2'')-IIIa antibiotic inactivation; gentamicin; kanamycin A; APH(2''); amikacin; aminoglycoside antibiotic; gentamicin A; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-phosphotransferase enzymes with modification regiospecificity based at the 2''-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics, specifically kanamycin, tobramycin and amikacin, by the ATP-dependent phosphorylation of the 3'-hydroxyl group of the compound. DELETED 35953 UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 5003 UPDATE OXA-691 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1235 UPDATE AAC(6')-Ib' AAC(6'); antibiotic inactivation; amikacin; aminoglycoside antibiotic; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. " 5001 UPDATE OXA-689 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5000 UPDATE OXA-688 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5007 UPDATE OXA-695 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5006 UPDATE OXA-694 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5005 UPDATE OXA-693 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2524 UPDATE AAC(2')-IIb antibiotic inactivation; aminoglycoside antibiotic; AAC(2'); kasugamycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 2'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 2-amino group of the compound. " 5009 UPDATE OXA-697 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5008 UPDATE OXA-696 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1238 UPDATE OXA-397 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1332 UPDATE APH(3')-IIIa antibiotic inactivation; aminoglycoside antibiotic; isepamicin; gentamicin; lividomycin; paromomycin; kanamycin A; APH(3'); gentamicin B; amikacin; ribostamycin; neomycin; butirosin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-phosphotransferase enzymes with modification regiospecificity based at the 3'-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics, specifically kanamycin and neomycin, by the ATP-dependent phosphorylation of the 3'-hydroxyl group of the compound. DELETED 36997 UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). UPDATED category_aro_name with amikacin UPDATED category_aro_cvterm_id with 35932 UPDATED category_aro_accession with 0000013 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Amikacin is an aminoglycoside antibiotic that works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with isepamicin UPDATED category_aro_cvterm_id with 36996 UPDATED category_aro_accession with 3000652 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with A semi-synthetic derivative of gentamicin B (hydroxyamino propionyl genamicin B). It is modified to combat microbial inactivation and has a slightly larger spectrum of activity compared to other aminoglycosides, including Ser marcescens, Enterobacteria, and K pneumoniae. UPDATED category_aro_name with lividomycin UPDATED category_aro_cvterm_id with 37002 UPDATED category_aro_accession with 3000658 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Lividomycins are aminoglycosidic antibiotics produced by Streptomyces lividus. They contain 2-amino-2,3-dideoxy-D-glucose. " 5770 UPDATE KPC-90 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; ARO_category "DELETED 35977 " 104 UPDATE OXA-61 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5776 UPDATE KPC-93 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; ARO_category "DELETED 35977 " 4813 UPDATE OXA-114m penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2047 UPDATE OXA-322 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 39 UPDATE AAC(3)-Ia antibiotic inactivation; AAC(3); gentamicin; sisomicin; astromicin; aminoglycoside antibiotic; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 3-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 3-amino group of the compound. DELETED 35933 UPDATED category_aro_name with astromicin UPDATED category_aro_cvterm_id with 35922 UPDATED category_aro_accession with 0000003 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Astromicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Astromicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 4810 UPDATE OXA-114j penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4817 UPDATE OXA-114r penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2043 UPDATE aadA8 antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-nucleotidyltransferase enzymes with modification regiospecificity based at the 3''-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics by transfer of an AMP group from an ATP substrate to the 3''-hydroxyl group of the compound. " 4815 UPDATE OXA-114p penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2041 UPDATE OXA-424 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1843 UPDATE rmtD gentamicin; 16S rRNA methyltransferase (G1405); arbekacin; antibiotic target alteration; amikacin; aminoglycoside antibiotic; gentamicin A; tobramycin; ARO_category "UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 4819 UPDATE OXA-114t penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4818 UPDATE OXA-114s penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2048 UPDATE OXA-57 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1844 UPDATE OXA-128 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4832 UPDATE OXA-494 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1536 UPDATE OXA-421 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4958 UPDATE OXA-632 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 642 UPDATE aadA25 antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-nucleotidyltransferase enzymes with modification regiospecificity based at the 3''-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics by transfer of an AMP group from an ATP substrate to the 3''-hydroxyl group of the compound. " 1532 UPDATE OXA-249 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1530 UPDATE OXA-67 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4952 UPDATE OXA-626 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4953 UPDATE OXA-627 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4950 UPDATE OXA-624 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4951 UPDATE OXA-625 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4956 UPDATE OXA-630 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4957 UPDATE OXA-631 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 430 UPDATE OXA-87 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4955 UPDATE OXA-629 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2143 UPDATE Borreliella burgdorferi 16S rRNA mutation conferring resistance to gentamicin antibiotic target alteration; aminoglycoside antibiotic; gentamicin C; gentamicin; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; ARO_category "UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 1596 UPDATE OXA-24 penam; antibiotic inactivation; carbapenem; BAL30072; cephalosporin; cefalotin; oxacillin; monobactam; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 339 UPDATE ANT(3'')-Ii-AAC(6')-IId fusion protein 2'-N-ethylnetilmicin; 5-episisomicin; aminoglycoside antibiotic; gentamicin; sisomicin; antibiotic inactivation; spectinomycin; netilmicin; aminoglycoside bifunctional resistance protein; streptomycin; dibekacin; gentamicin A; tobramycin; ARO_description; CARD_short_name; ARO_category; model_name; ARO_name "UPDATED ARO_description with ANT(3'')-II-AAC(6')-IId is an integron-encoded aminoglycoside acetyltransferase in S. marcescens. UPDATED CARD_short_name with ANT3II_ANT6II DELETED 36484 UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. UPDATED category_aro_name with aminoglycoside bifunctional resistance protein UPDATED category_aro_cvterm_id with 46171 UPDATED category_aro_accession with 3007419 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with Bifunctional aminoglycoside-inactivating enzymes composed of two separate functional domains. These proteins possess activity from both enzyme components, thereby conferring resistance to the combination of antibiotics from both domains, and may include acetylation, phosphorylation or nucleotidylation activity. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with tobramycin UPDATED category_aro_cvterm_id with 35969 UPDATED category_aro_accession with 0000052 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Tobramycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Tobramycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED model_name with ANT(3'')-II-AAC(6')-IId bifunctional protein UPDATED ARO_name with ANT(3'')-II-AAC(6')-IId bifunctional protein " 3805 UPDATE ParS erythromycin; penem; tetracycline antibiotic; meropenem; antibiotic efflux; imipenem; resistance-nodulation-cell division (RND) antibiotic efflux pump; ofloxacin; norfloxacin; macrolide antibiotic; reduced permeability to antibiotic; carbapenem; cephalosporin; ciprofloxacin; gentamicin C; amikacin; aminoglycoside antibiotic; disinfecting agents and antiseptics; protein(s) and two-component regulatory system modulating antibiotic efflux; penam; gentamicin; Outer Membrane Porin (Opr); efflux pump complex or subunit conferring antibiotic resistance; cephamycin; acriflavine; monobactam; fluoroquinolone antibiotic; chloramphenicol; phenicol antibiotic; tetracycline; tobramycin; ARO_category "UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 334 UPDATE mexX erythromycin; arbekacin; tetracycline antibiotic; meropenem; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; ofloxacin; norfloxacin; macrolide antibiotic; carbapenem; cephalosporin; ciprofloxacin; gentamicin C; amikacin; aminoglycoside antibiotic; disinfecting agents and antiseptics; penam; gentamicin; efflux pump complex or subunit conferring antibiotic resistance; cephamycin; acriflavine; fluoroquinolone antibiotic; chloramphenicol; phenicol antibiotic; tetracycline; tobramycin; ARO_category "UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 1093 UPDATE AAC(6')-31 antibiotic inactivation; kanamycin A; AAC(6'); aminoglycoside antibiotic; gentamicin; sisomicin; netilmicin; amikacin; isepamicin; neomycin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. DELETED 40942 UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 3806 UPDATE ParR erythromycin; penem; tetracycline antibiotic; meropenem; antibiotic efflux; imipenem; resistance-nodulation-cell division (RND) antibiotic efflux pump; ofloxacin; norfloxacin; macrolide antibiotic; reduced permeability to antibiotic; carbapenem; cephalosporin; ciprofloxacin; gentamicin C; amikacin; aminoglycoside antibiotic; disinfecting agents and antiseptics; protein(s) and two-component regulatory system modulating antibiotic efflux; penam; gentamicin; Outer Membrane Porin (Opr); efflux pump complex or subunit conferring antibiotic resistance; cephamycin; acriflavine; monobactam; fluoroquinolone antibiotic; chloramphenicol; phenicol antibiotic; tetracycline; tobramycin; ARO_category "UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 3801 UPDATE AAC(3)-IVb antibiotic inactivation; AAC(3); gentamicin; aminoglycoside antibiotic; gentamicin A; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 3-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 3-amino group of the compound. UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 3800 UPDATE OXA-837 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; ampicillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3802 UPDATE ANT(3'')-Ib antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-nucleotidyltransferase enzymes with modification regiospecificity based at the 3''-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics by transfer of an AMP group from an ATP substrate to the 3''-hydroxyl group of the compound. " 1372 UPDATE ANT(2'')-Ia antibiotic inactivation; kanamycin A; aminoglycoside antibiotic; gentamicin; sisomicin; ANT(2''); dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-nucleotidyltransferase enzymes with modification regiospecificity based at the 2''-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics by transfer of an AMP group from an ATP substrate to the 2''-hydroxyl group of the compound. DELETED 35933 UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 3298 UPDATE Klebsiella pneumoniae KpnG penem; piperacillin; antibiotic efflux; imipenem; major facilitator superfamily (MFS) antibiotic efflux pump; norfloxacin; cephalosporin; macrolide antibiotic; carbapenem; ceftazidime; spectinomycin; ciprofloxacin; gentamicin C; streptomycin; aminoglycoside antibiotic; polymyxin B1; polymyxin B; peptide antibiotic; ticarcillin; ertapenem; penam; gentamicin; efflux pump complex or subunit conferring antibiotic resistance; polymyxin B2; polymyxin B3; polymyxin B4; fluoroquinolone antibiotic; erythromycin; azithromycin; tobramycin; ARO_category "UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 4907 UPDATE OXA-581 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5139 UPDATE OXA-840 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5138 UPDATE OXA-839 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3294 UPDATE erm(32) methymycin; narbomycin; Erm 23S ribosomal RNA methyltransferase; pikromycin; macrolide antibiotic; antibiotic target alteration; streptogramin antibiotic; lincosamide antibiotic; ARO_category "UPDATED category_aro_name with methymycin UPDATED category_aro_cvterm_id with 37631 UPDATED category_aro_accession with 3001232 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Produced by Streptomyces venezuelae ATCC 15439. UPDATED category_aro_name with narbomycin UPDATED category_aro_cvterm_id with 37625 UPDATED category_aro_accession with 3001226 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Produced by Streptomyces narbonensis. UPDATED category_aro_name with pikromycin UPDATED category_aro_cvterm_id with 37632 UPDATED category_aro_accession with 3001233 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Produced by Streptomyces venezuelae ATCC 15439. " 5136 UPDATE OXA-834 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5135 UPDATE OXA-833 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5134 UPDATE OXA-832 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1902 UPDATE OXA-246 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5132 UPDATE OXA-830 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5131 UPDATE OXA-829 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5130 UPDATE OXA-828 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3452 UPDATE OXA-288 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3453 UPDATE OXA-289 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3450 UPDATE OXA-285 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3518 UPDATE OXA-449 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 850 UPDATE OXA-26 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3457 UPDATE OXA-294 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3454 UPDATE OXA-291 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3455 UPDATE OXA-292 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3513 UPDATE OXA-443 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3512 UPDATE OXA-442 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3511 UPDATE OXA-441 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3510 UPDATE OXA-440 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3517 UPDATE OXA-448 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3516 UPDATE OXA-447 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3515 UPDATE OXA-446 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3514 UPDATE OXA-444 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1186 UPDATE OXA-327 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4854 UPDATE OXA-519 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2688 UPDATE ArmR sulfonamide antibiotic; penem; panipenem; tetracycline antibiotic; meropenem; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; aztreonam; trimethoprim; aminocoumarin antibiotic; cephalosporin; macrolide antibiotic; carbapenem; ceftazidime; ciprofloxacin; cephamycin; ceftriaxone; colistin B; protein(s) and two-component regulatory system modulating antibiotic efflux; colistin A; peptide antibiotic; diaminopyrimidine antibiotic; ampicillin; penam; sulfamethoxazole; novobiocin; efflux pump complex or subunit conferring antibiotic resistance; trimethoprim-sulfamethoxazole; tetracycline; monobactam; fluoroquinolone antibiotic; erythromycin; phenicol antibiotic; azithromycin; chloramphenicol; ARO_category "DELETED 35996 " 2685 UPDATE Pseudomonas aeruginosa CpxR sulfonamide antibiotic; penem; panipenem; tetracycline antibiotic; meropenem; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; aztreonam; trimethoprim; aminocoumarin antibiotic; cephalosporin; macrolide antibiotic; carbapenem; ceftazidime; ciprofloxacin; cephamycin; aminoglycoside antibiotic; colistin B; protein(s) and two-component regulatory system modulating antibiotic efflux; colistin A; peptide antibiotic; diaminopyrimidine antibiotic; ampicillin; penam; ceftriaxone; sulfamethoxazole; novobiocin; efflux pump complex or subunit conferring antibiotic resistance; trimethoprim-sulfamethoxazole; tetracycline; monobactam; fluoroquinolone antibiotic; erythromycin; phenicol antibiotic; azithromycin; chloramphenicol; ARO_category "DELETED 35996 " 2686 UPDATE MexAB-OprM with CpxR regulator conferring resistance to ciprofloxacin, ceftazidime, and aztreonam sulfonamide antibiotic; penem; panipenem; tetracycline antibiotic; meropenem; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; aztreonam; trimethoprim; aminocoumarin antibiotic; cephalosporin; macrolide antibiotic; carbapenem; ceftazidime; ciprofloxacin; cephamycin; ceftriaxone; colistin B; colistin A; peptide antibiotic; diaminopyrimidine antibiotic; ampicillin; penam; sulfamethoxazole; novobiocin; efflux pump complex or subunit conferring antibiotic resistance; trimethoprim-sulfamethoxazole; tetracycline; monobactam; fluoroquinolone antibiotic; erythromycin; phenicol antibiotic; azithromycin; chloramphenicol; ARO_category "DELETED 35996 " 5123 UPDATE OXA-820 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2680 UPDATE MexAB-OprM with prematurely terminated MexR conferring resistance to meropenem and ciprofloxacin sulfonamide antibiotic; penem; panipenem; tetracycline antibiotic; meropenem; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; aztreonam; trimethoprim; aminocoumarin antibiotic; cephalosporin; macrolide antibiotic; carbapenem; ceftazidime; ciprofloxacin; cephamycin; ceftriaxone; colistin B; colistin A; peptide antibiotic; diaminopyrimidine antibiotic; ampicillin; penam; sulfamethoxazole; novobiocin; efflux pump complex or subunit conferring antibiotic resistance; trimethoprim-sulfamethoxazole; tetracycline; monobactam; fluoroquinolone antibiotic; erythromycin; phenicol antibiotic; azithromycin; chloramphenicol; ARO_category "DELETED 35996 " 2682 UPDATE MexAB-OprM with NalC mutations conferring resistance to aztreonam sulfonamide antibiotic; penem; panipenem; tetracycline antibiotic; meropenem; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; aztreonam; trimethoprim; aminocoumarin antibiotic; cephalosporin; macrolide antibiotic; carbapenem; ceftazidime; ciprofloxacin; cephamycin; ceftriaxone; colistin B; colistin A; peptide antibiotic; diaminopyrimidine antibiotic; ampicillin; penam; sulfamethoxazole; novobiocin; efflux pump complex or subunit conferring antibiotic resistance; trimethoprim-sulfamethoxazole; tetracycline; monobactam; fluoroquinolone antibiotic; erythromycin; phenicol antibiotic; azithromycin; chloramphenicol; ARO_category "DELETED 35996 " 2683 UPDATE MexAB-OprM with NalD mutations conferring resistance to multiple antibiotics sulfonamide antibiotic; penem; panipenem; tetracycline antibiotic; meropenem; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; aztreonam; trimethoprim; aminocoumarin antibiotic; cephalosporin; macrolide antibiotic; carbapenem; ceftazidime; ciprofloxacin; cephamycin; ceftriaxone; colistin B; colistin A; peptide antibiotic; diaminopyrimidine antibiotic; ticarcillin; ampicillin; penam; sulfamethoxazole; novobiocin; phenicol antibiotic; efflux pump complex or subunit conferring antibiotic resistance; trimethoprim-sulfamethoxazole; tetracycline; monobactam; fluoroquinolone antibiotic; erythromycin; nalidixic acid; azithromycin; chloramphenicol; ARO_category "DELETED 35996 " 3508 UPDATE OXA-438 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5173 UPDATE OXA-876 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3509 UPDATE OXA-439 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5089 UPDATE OXA-781 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1187 UPDATE OXA-248 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5088 UPDATE OXA-780 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 96 UPDATE OXA-426 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5182 UPDATE OXA-885 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5183 UPDATE OXA-886 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5229 UPDATE OXA-945 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5228 UPDATE OXA-943 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5186 UPDATE OXA-889 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5187 UPDATE OXA-890 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1625 UPDATE OXA-179 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5185 UPDATE OXA-888 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5223 UPDATE OXA-938 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4074 UPDATE OXA-653 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5188 UPDATE OXA-891 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4076 UPDATE OXA-825 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5227 UPDATE OXA-942 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5226 UPDATE OXA-941 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4073 UPDATE OXA-897 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5224 UPDATE OXA-939 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3500 UPDATE OXA-417 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3501 UPDATE OXA-427 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 461 UPDATE OXA-13 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5811 UPDATE KPC-123 penam; carbapenem; cephalosporin; cefotaxime; ceftazidime; cefepime; antibiotic inactivation; monobactam; KPC beta-lactamase; ARO_category "DELETED 45634 " 1293 UPDATE OXA-197 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3502 UPDATE OXA-429 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5817 UPDATE AAC(6')-Iap 2'-N-ethylnetilmicin; 5-episisomicin; AAC(6'); aminoglycoside antibiotic; sisomicin; antibiotic inactivation; netilmicin; amikacin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. DELETED 35966 UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. " 1317 UPDATE CTX-M-3 penam; antibiotic inactivation; cephalosporin; cefazolin; ceftazidime; cefalotin; cephamycin; ampicillin; cefixime; ceftriaxone; cefoxitin; CTX-M beta-lactamase; ARO_category "DELETED 35981 " 742 UPDATE AAC(3)-Id antibiotic inactivation; AAC(3); gentamicin; sisomicin; astromicin; aminoglycoside antibiotic; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 3-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 3-amino group of the compound. DELETED 35933 UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 5080 UPDATE OXA-771 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 746 UPDATE AAC(2')-Ib antibiotic inactivation; aminoglycoside antibiotic; gentamicin; AAC(2'); 6'-N-ethylnetilmicin; netilmicin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 2'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 2-amino group of the compound. DELETED 35932 UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. UPDATED category_aro_name with 6'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46127 UPDATED category_aro_accession with 3007377 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 6'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. " 4889 UPDATE OXA-560 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 555 UPDATE OXA-133 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 554 UPDATE OXA-163 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1185 UPDATE OXA-176 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3633 UPDATE OXA-724 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5086 UPDATE OXA-777 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5054 UPDATE OXA-745 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1314 UPDATE OXA-214 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 239 UPDATE OXA-83 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5026 UPDATE OXA-714 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5055 UPDATE OXA-746 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 235 UPDATE OXA-181 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "DELETED 40951 UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3507 UPDATE OXA-437 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 230 UPDATE OXA-422 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 231 UPDATE OXA-178 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5060 UPDATE OXA-751 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1050 UPDATE AAC(6')-Ii 2'-N-ethylnetilmicin; 5-episisomicin; AAC(6'); aminoglycoside antibiotic; sisomicin; antibiotic inactivation; netilmicin; amikacin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. DELETED 40307 UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. UPDATED category_aro_name with amikacin UPDATED category_aro_cvterm_id with 35932 UPDATED category_aro_accession with 0000013 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Amikacin is an aminoglycoside antibiotic that works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with tobramycin UPDATED category_aro_cvterm_id with 35969 UPDATED category_aro_accession with 0000052 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Tobramycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Tobramycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. " 1052 UPDATE OXA-206 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 909 UPDATE OXA-5 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 993 UPDATE AAC(6')-Ib9 antibiotic inactivation; AAC(6'); kanamycin A; amikacin; aminoglycoside antibiotic; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. UPDATED category_aro_name with kanamycin A UPDATED category_aro_cvterm_id with 35966 UPDATED category_aro_accession with 0000049 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Kanamycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Kanamycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with amikacin UPDATED category_aro_cvterm_id with 35932 UPDATED category_aro_accession with 0000013 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Amikacin is an aminoglycoside antibiotic that works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with tobramycin UPDATED category_aro_cvterm_id with 35969 UPDATED category_aro_accession with 0000052 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Tobramycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Tobramycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. " 2227 UPDATE VCC-1 penam; antibiotic inactivation; imipenem; aztreonam; VCC beta-lactamase; carbapenem; monobactam; ertapenem; doripenem; meropenem; ARO_category "UPDATED category_aro_name with imipenem UPDATED category_aro_cvterm_id with 36309 UPDATED category_aro_accession with 3000170 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Imipenem is a broad-spectrum antibiotic and is usually taken with cilastatin, which prevents hydrolysis of imipenem by renal dehydropeptidase-I. It is resistant to hydrolysis by most other beta-lactamases. Notable exceptions are the KPC beta-lactamases and Ambler Class B enzymes. UPDATED category_aro_name with meropenem UPDATED category_aro_cvterm_id with 35990 UPDATED category_aro_accession with 0000073 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Meropenem is an ultra-broad spectrum injectable antibiotic used to treat a wide variety of infections, including meningitis and pneumonia. It is a beta-lactam and belongs to the subgroup of carbapenem, similar to imipenem and ertapenem. UPDATED category_aro_name with doripenem UPDATED category_aro_cvterm_id with 36984 UPDATED category_aro_accession with 3000640 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Doripenem is a carbapenem with a broad range of activity against Gram-positive and Gram-negative bacteria, and along with meropenem, it is the most active beta-lactam antibiotic against Pseudomonas aeruginosa. It inhibits bacterial cell wall synthesis. UPDATED category_aro_name with ertapenem UPDATED category_aro_cvterm_id with 35987 UPDATED category_aro_accession with 0000070 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Ertapenem is a carbapenem antibiotic and is highly resistant to beta-lactamases like other carbapenems. It inhibits bacterial cell wall synthesis. UPDATED category_aro_name with aztreonam UPDATED category_aro_cvterm_id with 36689 UPDATED category_aro_accession with 3000550 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Aztreonam was the first monobactam discovered, and is greatly effective against Gram-negative bacteria while inactive against Gram-positive bacteria. Artreonam is a poor substrate for beta-lactamases, and may even act as an inhibitor. In Gram-negative bacteria, Aztreonam interferes with filamentation, inhibiting cell division and leading to cell death. " 3340 UPDATE aacA43 AAC(6'); kanamycin A; antibiotic inactivation; aminoglycoside antibiotic; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. " 5062 UPDATE OXA-753 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2223 UPDATE MexZ erythromycin; arbekacin; tetracycline antibiotic; meropenem; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; ofloxacin; norfloxacin; macrolide antibiotic; carbapenem; cephalosporin; ciprofloxacin; gentamicin C; amikacin; aminoglycoside antibiotic; disinfecting agents and antiseptics; protein(s) and two-component regulatory system modulating antibiotic efflux; penam; gentamicin; efflux pump complex or subunit conferring antibiotic resistance; cephamycin; acriflavine; fluoroquinolone antibiotic; chloramphenicol; phenicol antibiotic; tetracycline; tobramycin; ARO_category "UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 1196 UPDATE OXA-71 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5146 UPDATE OXA-848 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1694 UPDATE OXA-353 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 784 UPDATE AAC(6')-Iv 2'-N-ethylnetilmicin; 5-episisomicin; AAC(6'); aminoglycoside antibiotic; sisomicin; antibiotic inactivation; netilmicin; amikacin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. DELETED 35966 UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. " 1690 UPDATE OXA-317 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1758 UPDATE OXA-326 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5144 UPDATE OXA-845 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1750 UPDATE OXA-254 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 146 UPDATE OXA-98 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1176 UPDATE Mycobacterium tuberculosis katG mutations conferring resistance to isoniazid isoniazid; isoniazid resistant katG; antibiotic target alteration; isoniazid-like antibiotic; ARO_category; model_param "UPDATED category_aro_name with isoniazid UPDATED category_aro_cvterm_id with 36659 UPDATED category_aro_accession with 3000520 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Isoniazid is an organic compound that is the first-line anti tuberculosis medication in prevention and treatment. As a prodrug, it is activated by mycobacterial catalase-peroxidases such as M. tuberculosis KatG. Isoniazid inhibits mycolic acid synthesis, which prevents cell wall synthesis in mycobacteria. DELETED 3758 UPDATED 12838 with N596S,Y597H " 145 UPDATE OXA-229 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1172 UPDATE OXA-194 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 140 UPDATE AAC(6')-IIb 2'-N-ethylnetilmicin; 5-episisomicin; AAC(6'); aminoglycoside antibiotic; gentamicin; sisomicin; antibiotic inactivation; netilmicin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. DELETED 35966 UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. " 1271 UPDATE AAC(6')-Iw 2'-N-ethylnetilmicin; 5-episisomicin; AAC(6'); aminoglycoside antibiotic; sisomicin; antibiotic inactivation; netilmicin; amikacin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. DELETED 35966 UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. " 611 UPDATE OXA-328 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 617 UPDATE OXA-147 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1276 UPDATE OXA-210 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 149 UPDATE aadA12 antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-nucleotidyltransferase enzymes with modification regiospecificity based at the 3''-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics by transfer of an AMP group from an ATP substrate to the 3''-hydroxyl group of the compound. " 5140 UPDATE OXA-841 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5141 UPDATE OXA-842 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1610 UPDATE OXA-74 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1882 UPDATE OXA-80 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1881 UPDATE OXA-72 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1212 UPDATE OXA-141 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5085 UPDATE OXA-776 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1281 UPDATE OXA-110 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3438 UPDATE OXA-271 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4918 UPDATE OXA-592 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4919 UPDATE OXA-593 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4916 UPDATE OXA-590 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4917 UPDATE OXA-591 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4914 UPDATE OXA-588 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4915 UPDATE OXA-589 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4912 UPDATE OXA-586 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1288 UPDATE OXA-82 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4910 UPDATE OXA-584 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4911 UPDATE OXA-585 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1967 UPDATE OXA-116 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2060 UPDATE FosC2 fosfomycin; phosphonic acid antibiotic; antibiotic inactivation; fosC phosphotransferase family; ARO_category "UPDATED category_aro_name with fosfomycin UPDATED category_aro_cvterm_id with 35944 UPDATED category_aro_accession with 0000025 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Fosfomycin (also known as phosphomycin and phosphonomycin) is a broad-spectrum antibiotic produced by certain Streptomyces species. It is effective on gram positive and negative bacteria as it targets the cell wall, an essential feature shared by both bacteria. Its specific target is MurA (MurZ in E.coli), which attaches phosphoenolpyruvate (PEP) to UDP-N-acetylglucosamine, a step of commitment to cell wall synthesis. In the active site of MurA, the active cysteine molecule is alkylated which stops the catalytic reaction. " 1474 UPDATE MexR sulfonamide antibiotic; penem; panipenem; antibiotic target alteration; tetracycline antibiotic; meropenem; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; aztreonam; trimethoprim; aminocoumarin antibiotic; cephalosporin; macrolide antibiotic; carbapenem; ceftazidime; ciprofloxacin; cephamycin; ceftriaxone; colistin B; protein(s) and two-component regulatory system modulating antibiotic efflux; colistin A; peptide antibiotic; diaminopyrimidine antibiotic; ampicillin; penam; sulfamethoxazole; novobiocin; efflux pump complex or subunit conferring antibiotic resistance; trimethoprim-sulfamethoxazole; tetracycline; monobactam; fluoroquinolone antibiotic; erythromycin; phenicol antibiotic; azithromycin; chloramphenicol; ARO_category "DELETED 35996 " 1190 UPDATE OXA-354 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 685 UPDATE OXA-239 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1572 UPDATE OXA-205 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 687 UPDATE APH(3')-Vc antibiotic inactivation; aminoglycoside antibiotic; paromomycin; APH(3'); ribostamycin; neomycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-phosphotransferase enzymes with modification regiospecificity based at the 3'-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics, specifically kanamycin and neomycin, by the ATP-dependent phosphorylation of the 3'-hydroxyl group of the compound. DELETED 36997 " 686 UPDATE OXA-162 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1577 UPDATE AAC(6')-32 antibiotic inactivation; AAC(6'); gentamicin; amikacin; aminoglycoside antibiotic; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. DELETED 40942 UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 1576 UPDATE OXA-17 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1575 UPDATE OXA-91 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1574 UPDATE Mycobacterium tuberculosis inhA mutations conferring resistance to isoniazid isoniazid; antibiotic target alteration; isoniazid-like antibiotic; isoniazid resistant inhA; ARO_category "UPDATED category_aro_name with isoniazid UPDATED category_aro_cvterm_id with 36659 UPDATED category_aro_accession with 3000520 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Isoniazid is an organic compound that is the first-line anti tuberculosis medication in prevention and treatment. As a prodrug, it is activated by mycobacterial catalase-peroxidases such as M. tuberculosis KatG. Isoniazid inhibits mycolic acid synthesis, which prevents cell wall synthesis in mycobacteria. " 2712 UPDATE MexXY-OprA antibiotic efflux; tobramycin; resistance-nodulation-cell division (RND) antibiotic efflux pump; efflux pump complex or subunit conferring antibiotic resistance; ofloxacin; norfloxacin; meropenem; macrolide antibiotic; carbapenem; gentamicin; arbekacin; ciprofloxacin; tetracycline antibiotic; gentamicin C; amikacin; aminoglycoside antibiotic; fluoroquinolone antibiotic; tetracycline; erythromycin; ARO_category "UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 1305 UPDATE OprM sulfonamide antibiotic; tetracycline; erythromycin; penem; panipenem; thiamphenicol; tetracycline antibiotic; meropenem; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; aztreonam; ofloxacin; norfloxacin; nalidixic acid; aminocoumarin antibiotic; cephalosporin; macrolide antibiotic; carbapenem; ceftazidime; ciprofloxacin; cephamycin; gentamicin C; amikacin; ceftriaxone; disinfecting agents and antiseptics; colistin B; colistin A; peptide antibiotic; diaminopyrimidine antibiotic; ticarcillin; ampicillin; penam; aminoglycoside antibiotic; sulfamethoxazole; gentamicin; novobiocin; phenicol antibiotic; efflux pump complex or subunit conferring antibiotic resistance; trimethoprim-sulfamethoxazole; acriflavine; monobactam; fluoroquinolone antibiotic; chloramphenicol; trimethoprim; azithromycin; tobramycin; ARO_category "DELETED 35996 UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 5171 UPDATE OXA-874 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5170 UPDATE OXA-873 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5177 UPDATE OXA-880 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5176 UPDATE OXA-879 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5175 UPDATE OXA-878 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5174 UPDATE OXA-877 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5179 UPDATE OXA-882 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5178 UPDATE OXA-881 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2655 UPDATE Pseudomonas aeruginosa emrE antibiotic efflux; small multidrug resistance (SMR) antibiotic efflux pump; gentamicin; efflux pump complex or subunit conferring antibiotic resistance; gentamicin C; aminoglycoside antibiotic; ARO_category "UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 1194 UPDATE OXA-16 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3416 UPDATE OXA-152 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3417 UPDATE OXA-153 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5078 UPDATE OXA-769 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5079 UPDATE OXA-770 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5744 UPDATE msr(I) macrolide antibiotic; phosphonic acid antibiotic; msr-type ABC-F protein; antibiotic target protection; fosfomycin; streptogramin antibiotic; ARO_category "UPDATED category_aro_name with fosfomycin UPDATED category_aro_cvterm_id with 35944 UPDATED category_aro_accession with 0000025 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Fosfomycin (also known as phosphomycin and phosphonomycin) is a broad-spectrum antibiotic produced by certain Streptomyces species. It is effective on gram positive and negative bacteria as it targets the cell wall, an essential feature shared by both bacteria. Its specific target is MurA (MurZ in E.coli), which attaches phosphoenolpyruvate (PEP) to UDP-N-acetylglucosamine, a step of commitment to cell wall synthesis. In the active site of MurA, the active cysteine molecule is alkylated which stops the catalytic reaction. UPDATED category_aro_name with phosphonic acid antibiotic UPDATED category_aro_cvterm_id with 45731 UPDATED category_aro_accession with 3007149 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with A group of antibiotics derived from phosphonic acids. " 3413 UPDATE OXA-127 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3410 UPDATE OXA-124 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3411 UPDATE OXA-125 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5072 UPDATE OXA-763 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5073 UPDATE OXA-764 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5070 UPDATE OXA-761 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5071 UPDATE OXA-762 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5076 UPDATE OXA-767 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5077 UPDATE OXA-768 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3418 UPDATE OXA-154 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5075 UPDATE OXA-766 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1833 UPDATE OXA-374 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1830 UPDATE APH(3'')-Ib antibiotic inactivation; APH(3''); streptomycin; aminoglycoside antibiotic; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-phosphotransferase enzymes with modification regiospecificity based at the 3''-hydroxyl group of the respective antibiotic. These enzymes are characterized by enzymatic antibiotic inactivation, specifically of streptomycin, by the ATP-dependent phosphorylation of the 3''-hydroxyl group of the compound. " 1831 UPDATE AAC(6')-Iid 2'-N-ethylnetilmicin; 5-episisomicin; AAC(6'); aminoglycoside antibiotic; sisomicin; antibiotic inactivation; netilmicin; amikacin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. UPDATED category_aro_name with amikacin UPDATED category_aro_cvterm_id with 35932 UPDATED category_aro_accession with 0000013 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Amikacin is an aminoglycoside antibiotic that works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with tobramycin UPDATED category_aro_cvterm_id with 35969 UPDATED category_aro_accession with 0000052 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Tobramycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Tobramycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. " 1836 UPDATE OXA-201 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 21 UPDATE OXA-329 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 23 UPDATE OXA-371 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 914 UPDATE ANT(6)-Ia antibiotic inactivation; streptomycin; aminoglycoside antibiotic; ANT(6); ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-nucleotidyltransferase enzymes with modification regiospecificity based at the 6-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics, specifically streptomycin, by transfer of an AMP group from an ATP substrate to the 6-hydroxyl group of the compound. " 1839 UPDATE aadA14 antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-nucleotidyltransferase enzymes with modification regiospecificity based at the 3''-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics by transfer of an AMP group from an ATP substrate to the 3''-hydroxyl group of the compound. " 28 UPDATE OXA-45 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3412 UPDATE OXA-126 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 137 UPDATE APH(2'')-Ie antibiotic inactivation; gentamicin; kanamycin A; APH(2''); amikacin; aminoglycoside antibiotic; gentamicin A; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-phosphotransferase enzymes with modification regiospecificity based at the 2''-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics, specifically kanamycin, tobramycin and amikacin, by the ATP-dependent phosphorylation of the 3'-hydroxyl group of the compound. DELETED 35953 UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 407 UPDATE OXA-352 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4980 UPDATE OXA-660 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 405 UPDATE OXA-202 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4869 UPDATE OXA-534 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4985 UPDATE OXA-669 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4984 UPDATE OXA-667 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4987 UPDATE OXA-674 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4986 UPDATE OXA-670 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1379 UPDATE OXA-313 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1378 UPDATE AAC(3)-IIc 2'-N-ethylnetilmicin; antibiotic inactivation; AAC(3); aminoglycoside antibiotic; gentamicin; 6'-N-ethylnetilmicin; sisomicin; netilmicin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 3-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 3-amino group of the compound. DELETED 35966 UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). UPDATED category_aro_name with 6'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46127 UPDATED category_aro_accession with 3007377 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 6'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with tobramycin UPDATED category_aro_cvterm_id with 35969 UPDATED category_aro_accession with 0000052 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Tobramycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Tobramycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. " 931 UPDATE OXA-316 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2016 UPDATE OXA-370 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 937 UPDATE OXA-242 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4867 UPDATE OXA-532 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 935 UPDATE OXA-314 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 408 UPDATE OXA-380 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3834 UPDATE Mycobacterium tuberculosis katG mutations conferring resistance to prothionamide thioamide antibiotic; antibiotic target alteration; prothionamide resistant katG; prothionamide; ARO_category "UPDATED category_aro_name with prothionamide UPDATED category_aro_cvterm_id with 40958 UPDATED category_aro_accession with 3004025 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Prothionamide is a thioamide derivative with antibacterial properties. It increases cell wall permeability and decreases cell wall damage resistance by inhibition of mycolic acid synthesis, resulting in cell death. It is particularly used to treat M. tuberculosis and M. leprae infections. " 3836 UPDATE Mycobacterium tuberculosis ethA mutations conferring resistance to isoniazid isoniazid; isoniazid-like antibiotic; antibiotic target alteration; isoniazid resistant ethA; ARO_category "UPDATED category_aro_name with isoniazid UPDATED category_aro_cvterm_id with 36659 UPDATED category_aro_accession with 3000520 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Isoniazid is an organic compound that is the first-line anti tuberculosis medication in prevention and treatment. As a prodrug, it is activated by mycobacterial catalase-peroxidases such as M. tuberculosis KatG. Isoniazid inhibits mycolic acid synthesis, which prevents cell wall synthesis in mycobacteria. " 3837 UPDATE Mycobacterium tuberculosis ethA mutations conferring resistance to prothionamide thioamide antibiotic; antibiotic target alteration; prothionamide; prothionamide resistant ethA; ARO_category "UPDATED category_aro_name with prothionamide UPDATED category_aro_cvterm_id with 40958 UPDATED category_aro_accession with 3004025 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Prothionamide is a thioamide derivative with antibacterial properties. It increases cell wall permeability and decreases cell wall damage resistance by inhibition of mycolic acid synthesis, resulting in cell death. It is particularly used to treat M. tuberculosis and M. leprae infections. " 3832 UPDATE FosB2 fosfomycin; fosfomycin thiol transferase; antibiotic inactivation; phosphonic acid antibiotic; ARO_category "UPDATED category_aro_name with fosfomycin UPDATED category_aro_cvterm_id with 35944 UPDATED category_aro_accession with 0000025 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Fosfomycin (also known as phosphomycin and phosphonomycin) is a broad-spectrum antibiotic produced by certain Streptomyces species. It is effective on gram positive and negative bacteria as it targets the cell wall, an essential feature shared by both bacteria. Its specific target is MurA (MurZ in E.coli), which attaches phosphoenolpyruvate (PEP) to UDP-N-acetylglucosamine, a step of commitment to cell wall synthesis. In the active site of MurA, the active cysteine molecule is alkylated which stops the catalytic reaction. " 2179 UPDATE glycopeptide resistance gene cluster VanE glycopeptide antibiotic; glycopeptide resistance gene cluster; antibiotic target alteration; vancomycin; model_description "UPDATED model_description with Gene Cluster Meta-Models (GCM) are used to curate spatial clusters of individual genes within operons, such as for glycopeptide resistance gene clusters. The individual genes will have their own individual detection models (e.g. PHM, PVM, POM, etc.) while the GCM checks to see if all the component genes of the cluster have a Strict or Perfect hit and are ordered correctly within an operon. GCMs are encoded using the gene order parameter. This model type is still under development and not currently supported by the Resistance Gene Identifier (RGI) software. " 3838 UPDATE Mycobacterium tuberculosis mshA mutations conferring resistance to prothionamide thioamide antibiotic; antibiotic target alteration; prothionamide; prothionamide resistant mshA; ARO_category "UPDATED category_aro_name with prothionamide UPDATED category_aro_cvterm_id with 40958 UPDATED category_aro_accession with 3004025 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Prothionamide is a thioamide derivative with antibacterial properties. It increases cell wall permeability and decreases cell wall damage resistance by inhibition of mycolic acid synthesis, resulting in cell death. It is particularly used to treat M. tuberculosis and M. leprae infections. " 1955 UPDATE OXA-29 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1937 UPDATE OXA-118 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1952 UPDATE OXA-1 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; amoxicillin; ampicillin; cloxacillin; piperacillin; OXA beta-lactamase; ARO_category "DELETED 35996 UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 457 UPDATE OXA-93 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 916 UPDATE OXA-36 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4893 UPDATE OXA-564 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 379 UPDATE OXA-148 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3840 UPDATE AAC(6')-Ib-cr3 antibiotic inactivation; AAC(6')-Ib-cr; AAC(6'); kanamycin A; ciprofloxacin; fluoroquinolone antibiotic; amikacin; aminoglycoside antibiotic; tobramycin; ARO_category "UPDATED category_aro_name with AAC(6') UPDATED category_aro_cvterm_id with 36484 UPDATED category_aro_accession with 3000345 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. " 5690 UPDATE VHW-1 antibiotic inactivation; penam; carbapenem; cephalosporin; VHW beta-lactamase; ampicillin; ARO_category "UPDATED category_aro_name with penam UPDATED category_aro_cvterm_id with 36017 UPDATED category_aro_accession with 3000008 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_name with ampicillin UPDATED category_aro_cvterm_id with 36981 UPDATED category_aro_accession with 3000637 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Ampicillin is a penicillin derivative that is highly acid stable, with its activity similar to benzylpenicillin. " 3842 UPDATE AAC(6')-Ib-cr5 antibiotic inactivation; AAC(6')-Ib-cr; AAC(6'); kanamycin A; ciprofloxacin; fluoroquinolone antibiotic; amikacin; aminoglycoside antibiotic; tobramycin; ARO_category "UPDATED category_aro_name with AAC(6') UPDATED category_aro_cvterm_id with 36484 UPDATED category_aro_accession with 3000345 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. " 3845 UPDATE AAC(6')-Ib-cr8 antibiotic inactivation; AAC(6')-Ib-cr; AAC(6'); kanamycin A; ciprofloxacin; fluoroquinolone antibiotic; amikacin; aminoglycoside antibiotic; tobramycin; ARO_category "UPDATED category_aro_name with AAC(6') UPDATED category_aro_cvterm_id with 36484 UPDATED category_aro_accession with 3000345 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. " 3844 UPDATE AAC(6')-Ib-cr7 antibiotic inactivation; AAC(6')-Ib-cr; AAC(6'); kanamycin A; ciprofloxacin; fluoroquinolone antibiotic; amikacin; aminoglycoside antibiotic; tobramycin; ARO_category "UPDATED category_aro_name with AAC(6') UPDATED category_aro_cvterm_id with 36484 UPDATED category_aro_accession with 3000345 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. " 3846 UPDATE AAC(6')-Ib-cr9 antibiotic inactivation; AAC(6')-Ib-cr; AAC(6'); kanamycin A; ciprofloxacin; fluoroquinolone antibiotic; amikacin; aminoglycoside antibiotic; tobramycin; ARO_category "UPDATED category_aro_name with AAC(6') UPDATED category_aro_cvterm_id with 36484 UPDATED category_aro_accession with 3000345 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. " 826 UPDATE TolC tetracycline; erythromycin; penem; tetracycline antibiotic; piperacillin; antibiotic efflux; ATP-binding cassette (ABC) antibiotic efflux pump; major facilitator superfamily (MFS) antibiotic efflux pump; resistance-nodulation-cell division (RND) antibiotic efflux pump; norfloxacin; nalidixic acid; aminocoumarin antibiotic; cephalosporin; macrolide antibiotic; carbapenem; ceftazidime; cefalotin; spectinomycin; glycylcycline; oxacillin; ciprofloxacin; cloxacillin; gentamicin C; streptomycin; aminoglycoside antibiotic; disinfecting agents and antiseptics; polymyxin B3; polymyxin B1; polymyxin B; rifamycin antibiotic; imipenem; peptide antibiotic; rifampin; ticarcillin; ampicillin; ertapenem; penam; triclosan; gentamicin; novobiocin; efflux pump complex or subunit conferring antibiotic resistance; polymyxin B2; tigecycline; polymyxin B4; cephamycin; fluoroquinolone antibiotic; tobramycin; phenicol antibiotic; azithromycin; chloramphenicol; ARO_category "UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 4062 UPDATE OXA-931 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 605 UPDATE OXA-96 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 147 UPDATE OXA-27 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 704 UPDATE OprJ penam; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; ofloxacin; aminocoumarin antibiotic; trimethoprim; gentamicin; novobiocin; macrolide antibiotic; phenicol antibiotic; efflux pump complex or subunit conferring antibiotic resistance; cephalosporin; diaminopyrimidine antibiotic; tetracycline antibiotic; gentamicin C; chloramphenicol; aminoglycoside antibiotic; fluoroquinolone antibiotic; tetracycline; erythromycin; ARO_category "UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 4879 UPDATE OXA-550 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 706 UPDATE APH(7'')-Ia antibiotic inactivation; APH(7''); hygromycin B; aminoglycoside antibiotic; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-phosphotransferase enzymes with modification regiospecificity based at the 7''-hydroxyl group of the respective antibiotic. These enzymes are characterized by enzymatic antibiotic inactivation, specifically of hygromycin, by the ATP-dependent phosphorylation of the 7''-hydroxyl group of the compound. " 1483 UPDATE AAC(3)-Xa kanamycin A; antibiotic inactivation; AAC(3); aminoglycoside antibiotic; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 3-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 3-amino group of the compound. " 392 UPDATE TUS-1 penam; antibiotic inactivation; TUS beta-lactamase; penem; carbapenem; cephalosporin; cephamycin; ticarcillin; amoxicillin; piperacillin; ARO_category "UPDATED category_aro_name with penam UPDATED category_aro_cvterm_id with 36017 UPDATED category_aro_accession with 3000008 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_name with amoxicillin UPDATED category_aro_cvterm_id with 35981 UPDATED category_aro_accession with 0000064 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Amoxicillin is a moderate-spectrum, bacteriolytic, beta-lactam antibiotic used to treat bacterial infections caused by susceptible microorganisms. A derivative of penicillin, it has a wider range of treatment but remains relatively ineffective against Gram-negative bacteria. It is commonly taken with clavulanic acid, a beta-lactamase inhibitor. Like other beta-lactams, amoxicillin interferes with the synthesis of peptidoglycan. UPDATED category_aro_name with piperacillin UPDATED category_aro_cvterm_id with 35995 UPDATED category_aro_accession with 0000078 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Piperacillin is an acetylureidopenicillin and has an extended spectrum of targets relative to other beta-lactam antibiotics. It inhibits cell wall synthesis in bacteria, and is usually taken with the beta-lactamase inhibitor tazobactam to overcome penicillin-resistant bacteria. UPDATED category_aro_name with penem UPDATED category_aro_cvterm_id with 40360 UPDATED category_aro_accession with 3003706 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Penems are a class of unsaturated beta-lactam antibiotics with a broad spectrum of antibacterial activity and have a structure which renders them highly resistant to beta-lactamases. All penems are all synthetically made and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. They are structurally similar to carbapenems, however, where carbapenems have a carbon, penems have a sulfur. UPDATED category_aro_name with ticarcillin UPDATED category_aro_cvterm_id with 40523 UPDATED category_aro_accession with 3003832 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Ticarcillin is a carboxypenicillin used for the treatment of Gram-negative bacteria, particularly P. aeruginosa. Ticarcillin's antibiotic properties arise from its ability to prevent cross-linking of peptidoglycan during cell wall synthesis, when the bacteria try to divide, causing cell death. " 391 UPDATE VIM-2 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; ARO_category "DELETED 36727 " 397 UPDATE OXA-357 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 394 UPDATE OXA-130 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 795 UPDATE OXA-324 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4047 UPDATE OXA-779 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1717 UPDATE OXA-230 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1716 UPDATE OXA-398 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1715 UPDATE OXA-73 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4048 UPDATE OXA-838 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4049 UPDATE OXA-539 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1659 UPDATE OXA-258 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1653 UPDATE AAC(6')-Ip 2'-N-ethylnetilmicin; 5-episisomicin; AAC(6'); aminoglycoside antibiotic; sisomicin; antibiotic inactivation; netilmicin; amikacin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. UPDATED category_aro_name with amikacin UPDATED category_aro_cvterm_id with 35932 UPDATED category_aro_accession with 0000013 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Amikacin is an aminoglycoside antibiotic that works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with tobramycin UPDATED category_aro_cvterm_id with 35969 UPDATED category_aro_accession with 0000052 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Tobramycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Tobramycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. " 1651 UPDATE AAC(6')-If 2'-N-ethylnetilmicin; 5-episisomicin; AAC(6'); aminoglycoside antibiotic; sisomicin; antibiotic inactivation; netilmicin; amikacin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. DELETED 35966 UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. " 1657 UPDATE AAC(6')-IIa 2'-N-ethylnetilmicin; 5-episisomicin; AAC(6'); aminoglycoside antibiotic; gentamicin; sisomicin; antibiotic inactivation; netilmicin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. DELETED 35966 UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. " 410 UPDATE AAC(3)-IIIb antibiotic inactivation; kanamycin A; AAC(3); 5-episisomicin; aminoglycoside antibiotic; gentamicin; lividomycin; paromomycin; sisomicin; dibekacin; neomycin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 3-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 3-amino group of the compound. UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). UPDATED category_aro_name with lividomycin UPDATED category_aro_cvterm_id with 37002 UPDATED category_aro_accession with 3000658 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Lividomycins are aminoglycosidic antibiotics produced by Streptomyces lividus. They contain 2-amino-2,3-dideoxy-D-glucose. UPDATED category_aro_name with paromomycin UPDATED category_aro_cvterm_id with 37001 UPDATED category_aro_accession with 3000657 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with An aminoglycoside antibiotic used for the treatment of parasitic infections. It is similar to neomycin sharing a similar spectrum of activity, but its hydroxyl group at the 6'-position instead of an amino group makes it resistant to AAC(6') modifying enzymes. UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with neomycin UPDATED category_aro_cvterm_id with 35924 UPDATED category_aro_accession with 0000005 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Neomycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Neomycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with tobramycin UPDATED category_aro_cvterm_id with 35969 UPDATED category_aro_accession with 0000052 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Tobramycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Tobramycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. " 584 UPDATE aadA21 antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-nucleotidyltransferase enzymes with modification regiospecificity based at the 3''-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics by transfer of an AMP group from an ATP substrate to the 3''-hydroxyl group of the compound. " 4944 UPDATE OXA-618 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1132 UPDATE OXA-88 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1131 UPDATE AAC(3)-Ic antibiotic inactivation; AAC(3); gentamicin; sisomicin; astromicin; aminoglycoside antibiotic; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 3-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 3-amino group of the compound. DELETED 35933 UPDATED category_aro_name with astromicin UPDATED category_aro_cvterm_id with 35922 UPDATED category_aro_accession with 0000003 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Astromicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Astromicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 2284 UPDATE Escherichia coli murA with mutation conferring resistance to fosfomycin fosfomycin; phosphonic acid antibiotic; antibiotic target alteration; antibiotic-resistant murA transferase; ARO_category "UPDATED category_aro_name with fosfomycin UPDATED category_aro_cvterm_id with 35944 UPDATED category_aro_accession with 0000025 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Fosfomycin (also known as phosphomycin and phosphonomycin) is a broad-spectrum antibiotic produced by certain Streptomyces species. It is effective on gram positive and negative bacteria as it targets the cell wall, an essential feature shared by both bacteria. Its specific target is MurA (MurZ in E.coli), which attaches phosphoenolpyruvate (PEP) to UDP-N-acetylglucosamine, a step of commitment to cell wall synthesis. In the active site of MurA, the active cysteine molecule is alkylated which stops the catalytic reaction. " 2285 UPDATE Staphylococcus aureus murA with mutation conferring resistance to fosfomycin fosfomycin; phosphonic acid antibiotic; antibiotic target alteration; antibiotic-resistant murA transferase; ARO_category "UPDATED category_aro_name with fosfomycin UPDATED category_aro_cvterm_id with 35944 UPDATED category_aro_accession with 0000025 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Fosfomycin (also known as phosphomycin and phosphonomycin) is a broad-spectrum antibiotic produced by certain Streptomyces species. It is effective on gram positive and negative bacteria as it targets the cell wall, an essential feature shared by both bacteria. Its specific target is MurA (MurZ in E.coli), which attaches phosphoenolpyruvate (PEP) to UDP-N-acetylglucosamine, a step of commitment to cell wall synthesis. In the active site of MurA, the active cysteine molecule is alkylated which stops the catalytic reaction. " 2286 UPDATE Borreliella burgdorferi murA with mutation conferring resistance to fosfomycin fosfomycin; phosphonic acid antibiotic; antibiotic target alteration; antibiotic-resistant murA transferase; ARO_category "UPDATED category_aro_name with fosfomycin UPDATED category_aro_cvterm_id with 35944 UPDATED category_aro_accession with 0000025 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Fosfomycin (also known as phosphomycin and phosphonomycin) is a broad-spectrum antibiotic produced by certain Streptomyces species. It is effective on gram positive and negative bacteria as it targets the cell wall, an essential feature shared by both bacteria. Its specific target is MurA (MurZ in E.coli), which attaches phosphoenolpyruvate (PEP) to UDP-N-acetylglucosamine, a step of commitment to cell wall synthesis. In the active site of MurA, the active cysteine molecule is alkylated which stops the catalytic reaction. " 1384 UPDATE OXA-382 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4946 UPDATE OXA-620 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4071 UPDATE OXA-646 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 243 UPDATE OXA-9 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2837 UPDATE APH(2'')-If antibiotic inactivation; kanamycin A; aminoglycoside antibiotic; gentamicin; sisomicin; APH(2''); dibekacin; gentamicin A; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-phosphotransferase enzymes with modification regiospecificity based at the 2''-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics, specifically kanamycin, tobramycin and amikacin, by the ATP-dependent phosphorylation of the 3'-hydroxyl group of the compound. DELETED 36998 UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 4941 UPDATE OXA-615 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 615 UPDATE OXA-211 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 675 UPDATE OXA-25 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2832 UPDATE AAC(2')-Ie antibiotic inactivation; aminoglycoside antibiotic; gentamicin; AAC(2'); 6'-N-ethylnetilmicin; netilmicin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 2'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 2-amino group of the compound. DELETED 35932 UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. UPDATED category_aro_name with 6'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46127 UPDATED category_aro_accession with 3007377 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 6'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. " 2276 UPDATE Staphylococcus aureus ileS with mutation conferring resistance to mupirocin antibiotic-resistant isoleucyl-tRNA synthetase (ileS); antibiotic target alteration; mupirocin-like antibiotic; mupirocin; ARO_category "UPDATED category_aro_name with mupirocin UPDATED category_aro_cvterm_id with 36693 UPDATED category_aro_accession with 3000554 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Mupirocin, also known as pseudomonic acid, is a bacteriostatic polyketide antibiotic from Pseudomonas fluorescens used to treat S. aureus and MRSA. It inhibits Ile tRNA synthetase. " 4943 UPDATE OXA-617 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3399 UPDATE aadA8b antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-nucleotidyltransferase enzymes with modification regiospecificity based at the 3''-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics by transfer of an AMP group from an ATP substrate to the 3''-hydroxyl group of the compound. " 3398 UPDATE aadA10 antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-nucleotidyltransferase enzymes with modification regiospecificity based at the 3''-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics by transfer of an AMP group from an ATP substrate to the 3''-hydroxyl group of the compound. " 4942 UPDATE OXA-616 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 925 UPDATE AAC(3)-IIb 2'-N-ethylnetilmicin; antibiotic inactivation; AAC(3); aminoglycoside antibiotic; gentamicin; 6'-N-ethylnetilmicin; sisomicin; netilmicin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 3-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 3-amino group of the compound. DELETED 35932 UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). UPDATED category_aro_name with 6'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46127 UPDATED category_aro_accession with 3007377 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 6'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with tobramycin UPDATED category_aro_cvterm_id with 35969 UPDATED category_aro_accession with 0000052 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Tobramycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Tobramycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. " 4972 UPDATE OXA-651 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5231 UPDATE OXA-947 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 927 UPDATE OXA-381 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1003 UPDATE OXA-18 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1002 UPDATE AAC(6')-Ib4 antibiotic inactivation; AAC(6'); kanamycin A; amikacin; aminoglycoside antibiotic; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. DELETED 40942 UPDATED category_aro_name with kanamycin A UPDATED category_aro_cvterm_id with 35966 UPDATED category_aro_accession with 0000049 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Kanamycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Kanamycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with amikacin UPDATED category_aro_cvterm_id with 35932 UPDATED category_aro_accession with 0000013 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Amikacin is an aminoglycoside antibiotic that works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with tobramycin UPDATED category_aro_cvterm_id with 35969 UPDATED category_aro_accession with 0000052 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Tobramycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Tobramycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. " 1000 UPDATE AAC(6')-Ib-Hangzhou antibiotic inactivation; AAC(6'); kanamycin A; amikacin; aminoglycoside antibiotic; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. UPDATED category_aro_name with kanamycin A UPDATED category_aro_cvterm_id with 35966 UPDATED category_aro_accession with 0000049 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Kanamycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Kanamycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with amikacin UPDATED category_aro_cvterm_id with 35932 UPDATED category_aro_accession with 0000013 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Amikacin is an aminoglycoside antibiotic that works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with tobramycin UPDATED category_aro_cvterm_id with 35969 UPDATED category_aro_accession with 0000052 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Tobramycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Tobramycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. " 1227 UPDATE aadA2 antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-nucleotidyltransferase enzymes with modification regiospecificity based at the 3''-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics by transfer of an AMP group from an ATP substrate to the 3''-hydroxyl group of the compound. " 1087 UPDATE OXA-253 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 620 UPDATE OXA-320 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5038 UPDATE OXA-728 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5039 UPDATE OXA-729 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5036 UPDATE OXA-726 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5037 UPDATE OXA-727 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5034 UPDATE OXA-722 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1343 UPDATE OXA-166 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5032 UPDATE OXA-720 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5033 UPDATE OXA-721 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5030 UPDATE OXA-718 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5031 UPDATE OXA-719 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1862 UPDATE OXA-109 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1874 UPDATE OXA-196 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1870 UPDATE OXA-66 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1871 UPDATE OXA-389 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 978 UPDATE OXA-134 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4895 UPDATE OXA-566 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1879 UPDATE AAC(3)-IIIa antibiotic inactivation; kanamycin A; AAC(3); 5-episisomicin; aminoglycoside antibiotic; gentamicin; lividomycin; paromomycin; sisomicin; dibekacin; neomycin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 3-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 3-amino group of the compound. DELETED 35933 UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). UPDATED category_aro_name with lividomycin UPDATED category_aro_cvterm_id with 37002 UPDATED category_aro_accession with 3000658 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Lividomycins are aminoglycosidic antibiotics produced by Streptomyces lividus. They contain 2-amino-2,3-dideoxy-D-glucose. UPDATED category_aro_name with paromomycin UPDATED category_aro_cvterm_id with 37001 UPDATED category_aro_accession with 3000657 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with An aminoglycoside antibiotic used for the treatment of parasitic infections. It is similar to neomycin sharing a similar spectrum of activity, but its hydroxyl group at the 6'-position instead of an amino group makes it resistant to AAC(6') modifying enzymes. UPDATED category_aro_name with kanamycin A UPDATED category_aro_cvterm_id with 35966 UPDATED category_aro_accession with 0000049 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Kanamycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Kanamycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with neomycin UPDATED category_aro_cvterm_id with 35924 UPDATED category_aro_accession with 0000005 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Neomycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Neomycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with tobramycin UPDATED category_aro_cvterm_id with 35969 UPDATED category_aro_accession with 0000052 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Tobramycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Tobramycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. " 977 UPDATE OXA-112 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2050 UPDATE OXA-331 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4947 UPDATE OXA-621 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2052 UPDATE APH(3'')-Ic antibiotic inactivation; APH(3''); streptomycin; aminoglycoside antibiotic; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-phosphotransferase enzymes with modification regiospecificity based at the 3''-hydroxyl group of the respective antibiotic. These enzymes are characterized by enzymatic antibiotic inactivation, specifically of streptomycin, by the ATP-dependent phosphorylation of the 3''-hydroxyl group of the compound. " 973 UPDATE OXA-378 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4940 UPDATE OXA-614 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4828 UPDATE OXA-396 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4829 UPDATE OXA-489 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4826 UPDATE OXA-307 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4827 UPDATE OXA-395 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4824 UPDATE OXA-159 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4825 UPDATE OXA-193 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4822 UPDATE OXA-114w penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4823 UPDATE OXA-114x penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4820 UPDATE OXA-114u penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4821 UPDATE OXA-114v penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1502 UPDATE OXA-209 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1500 UPDATE APH(6)-Ia antibiotic inactivation; APH(6); streptomycin; aminoglycoside antibiotic; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-phosphotransferase enzymes with modification regiospecificity based at the 6-hydroxyl group of the respective antibiotic. These enzymes are characterized by enzymatic antibiotic inactivation, specifically of streptomycin, by the ATP-dependent phosphorylation of the 6-hydroxyl group of the compound. DELETED 40307 " 655 UPDATE OXA-243 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 186 UPDATE OXA-12 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 187 UPDATE OXA-348 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 650 UPDATE aadA antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-nucleotidyltransferase enzymes with modification regiospecificity based at the 3''-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics by transfer of an AMP group from an ATP substrate to the 3''-hydroxyl group of the compound. " 185 UPDATE OXA-232 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 853 UPDATE OXA-160 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2114 UPDATE APH(3')-IIa antibiotic inactivation; aminoglycoside antibiotic; gentamicin; paromomycin; kanamycin A; APH(3'); gentamicin B; ribostamycin; neomycin; butirosin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-phosphotransferase enzymes with modification regiospecificity based at the 3'-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics, specifically kanamycin and neomycin, by the ATP-dependent phosphorylation of the 3'-hydroxyl group of the compound. DELETED 36997 UPDATED category_aro_name with kanamycin A UPDATED category_aro_cvterm_id with 35966 UPDATED category_aro_accession with 0000049 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Kanamycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Kanamycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 1122 UPDATE OXA-180 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 659 UPDATE AAC(6')-29b antibiotic inactivation; aminoglycoside antibiotic; AAC(6'); dibekacin; kanamycin A; amikacin; isepamicin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. " 3879 UPDATE APH(3')-XV kanamycin A; APH(3'); amikacin; aminoglycoside antibiotic; antibiotic inactivation; ARO_description; CARD_short_name; ARO_category; model_name; ARO_name "UPDATED ARO_description with APH(3')-XVa is an aminoglycoside O-phosphotransferase found in Pseudomonas aeruginosa. UPDATED CARD_short_name with APH(3')-XVa UPDATED category_aro_description with A category of aminoglycoside O-phosphotransferase enzymes with modification regiospecificity based at the 3'-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics, specifically kanamycin and neomycin, by the ATP-dependent phosphorylation of the 3'-hydroxyl group of the compound. DELETED 36997 UPDATED model_name with APH(3')-XVa UPDATED ARO_name with APH(3')-XVa " 3545 UPDATE OXA-484 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 676 UPDATE AAC(6')-Ih 2'-N-ethylnetilmicin; 5-episisomicin; AAC(6'); aminoglycoside antibiotic; sisomicin; antibiotic inactivation; netilmicin; amikacin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. DELETED 35966 UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. " 5019 UPDATE OXA-707 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3526 UPDATE OXA-459 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1918 UPDATE spd antibiotic inactivation; aminoglycoside antibiotic; spectinomycin; ANT(9); ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-nucleotidyltransferase enzymes with modification regiospecificity based at the 9-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics, specifically streptomycin, by transfer of an AMP group from an ATP substrate to the 9-hydroxyl group of the compound. " 3524 UPDATE OXA-457 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5109 UPDATE OXA-804 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3522 UPDATE OXA-453 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3523 UPDATE OXA-455 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3520 UPDATE OXA-451 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3521 UPDATE OXA-452 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5102 UPDATE OXA-797 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5103 UPDATE OXA-798 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5100 UPDATE OXA-795 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5101 UPDATE OXA-796 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5106 UPDATE OXA-801 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5107 UPDATE OXA-802 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3528 UPDATE OXA-461 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3529 UPDATE OXA-464 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3885 UPDATE OXA-812 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3884 UPDATE OXA-818 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3886 UPDATE FosA7.5 fosfomycin; fosfomycin thiol transferase; antibiotic inactivation; phosphonic acid antibiotic; ARO_category "UPDATED category_aro_name with fosfomycin UPDATED category_aro_cvterm_id with 35944 UPDATED category_aro_accession with 0000025 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Fosfomycin (also known as phosphomycin and phosphonomycin) is a broad-spectrum antibiotic produced by certain Streptomyces species. It is effective on gram positive and negative bacteria as it targets the cell wall, an essential feature shared by both bacteria. Its specific target is MurA (MurZ in E.coli), which attaches phosphoenolpyruvate (PEP) to UDP-N-acetylglucosamine, a step of commitment to cell wall synthesis. In the active site of MurA, the active cysteine molecule is alkylated which stops the catalytic reaction. " 3449 UPDATE OXA-284 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3448 UPDATE OXA-283 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3883 UPDATE OXA-668 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 861 UPDATE OXA-215 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 18 UPDATE OXA-212 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3447 UPDATE OXA-282 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3446 UPDATE OXA-281 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 865 UPDATE OXA-244 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3440 UPDATE OXA-273 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3443 UPDATE OXA-277 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3442 UPDATE OXA-276 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2026 UPDATE OXA-84 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2755 UPDATE ANT(3'')-IIc antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-nucleotidyltransferase enzymes with modification regiospecificity based at the 3''-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics by transfer of an AMP group from an ATP substrate to the 3''-hydroxyl group of the compound. " 2752 UPDATE ANT(3'')-IIa antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-nucleotidyltransferase enzymes with modification regiospecificity based at the 3''-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics by transfer of an AMP group from an ATP substrate to the 3''-hydroxyl group of the compound. " 2750 UPDATE APH(3')-VIIIb kanamycin A; APH(3'); amikacin; aminoglycoside antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-phosphotransferase enzymes with modification regiospecificity based at the 3'-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics, specifically kanamycin and neomycin, by the ATP-dependent phosphorylation of the 3'-hydroxyl group of the compound. DELETED 36997 " 2128 UPDATE Mycobacteroides abscessus 16S rRNA mutation conferring resistance to gentamicin antibiotic target alteration; aminoglycoside antibiotic; gentamicin C; gentamicin; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; ARO_category "UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 2695 UPDATE MexCD-OprJ with type B NfxB mutation penam; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; ofloxacin; aminocoumarin antibiotic; trimethoprim; gentamicin; novobiocin; macrolide antibiotic; phenicol antibiotic; efflux pump complex or subunit conferring antibiotic resistance; cephalosporin; diaminopyrimidine antibiotic; tetracycline antibiotic; gentamicin C; chloramphenicol; aminoglycoside antibiotic; fluoroquinolone antibiotic; tetracycline; erythromycin; ARO_category "UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 2117 UPDATE AAC(6')-Ib7 antibiotic inactivation; AAC(6'); kanamycin A; amikacin; aminoglycoside antibiotic; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. UPDATED category_aro_name with kanamycin A UPDATED category_aro_cvterm_id with 35966 UPDATED category_aro_accession with 0000049 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Kanamycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Kanamycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with amikacin UPDATED category_aro_cvterm_id with 35932 UPDATED category_aro_accession with 0000013 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Amikacin is an aminoglycoside antibiotic that works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with tobramycin UPDATED category_aro_cvterm_id with 35969 UPDATED category_aro_accession with 0000052 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Tobramycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Tobramycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. " 2693 UPDATE Type B NfxB penam; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; protein(s) and two-component regulatory system modulating antibiotic efflux; ofloxacin; aminocoumarin antibiotic; trimethoprim; gentamicin; novobiocin; macrolide antibiotic; phenicol antibiotic; efflux pump complex or subunit conferring antibiotic resistance; cephalosporin; diaminopyrimidine antibiotic; tetracycline antibiotic; gentamicin C; chloramphenicol; aminoglycoside antibiotic; fluoroquinolone antibiotic; tetracycline; erythromycin; ARO_category "UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 656 UPDATE OXA-219 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 880 UPDATE APH(6)-Ib antibiotic inactivation; APH(6); streptomycin; aminoglycoside antibiotic; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-phosphotransferase enzymes with modification regiospecificity based at the 6-hydroxyl group of the respective antibiotic. These enzymes are characterized by enzymatic antibiotic inactivation, specifically of streptomycin, by the ATP-dependent phosphorylation of the 6-hydroxyl group of the compound. " 4863 UPDATE OXA-528 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 942 UPDATE OXA-104 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2256 UPDATE Staphylococcus aureus fusE with mutation conferring resistance to fusidic acid antibiotic resistant fusE; antibiotic target alteration; fusidic acid; fusidane antibiotic; ARO_category "UPDATED category_aro_name with fusidic acid UPDATED category_aro_cvterm_id with 37139 UPDATED category_aro_accession with 3000759 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Fusidic acid is the only commercially available fusidane, a group of steroid-like antibiotics. It is most active against Gram-positive bacteria, and acts by inhibiting elongation factor G to block protein synthesis. " 2087 UPDATE aadA13 antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-nucleotidyltransferase enzymes with modification regiospecificity based at the 3''-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics by transfer of an AMP group from an ATP substrate to the 3''-hydroxyl group of the compound. " 5216 UPDATE OXA-925 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5217 UPDATE OXA-927 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5214 UPDATE OXA-923 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5215 UPDATE OXA-924 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5212 UPDATE OXA-921 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5213 UPDATE OXA-922 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5210 UPDATE OXA-919 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5211 UPDATE OXA-920 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5011 UPDATE OXA-699 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5218 UPDATE OXA-928 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5219 UPDATE OXA-929 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5199 UPDATE OXA-907 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5198 UPDATE OXA-905 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1618 UPDATE OXA-362 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 30 UPDATE OXA-226 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5195 UPDATE OXA-902 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5194 UPDATE OXA-901 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5197 UPDATE OXA-904 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1615 UPDATE APH(2'')-IIa antibiotic inactivation; APH(2''); aminoglycoside antibiotic; plazomicin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-phosphotransferase enzymes with modification regiospecificity based at the 2''-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics, specifically kanamycin, tobramycin and amikacin, by the ATP-dependent phosphorylation of the 3'-hydroxyl group of the compound. DELETED 35953 " 5191 UPDATE OXA-894 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5190 UPDATE OXA-893 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1962 UPDATE OXA-47 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5192 UPDATE OXA-896 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 323 UPDATE aadA9 antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-nucleotidyltransferase enzymes with modification regiospecificity based at the 3''-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics by transfer of an AMP group from an ATP substrate to the 3''-hydroxyl group of the compound. " 5809 UPDATE glycopeptide resistance gene cluster vanP glycopeptide antibiotic; glycopeptide resistance gene cluster; antibiotic target alteration; vancomycin; teicoplanin; model_description "UPDATED model_description with Gene Cluster Meta-Models (GCM) are used to curate spatial clusters of individual genes within operons, such as for glycopeptide resistance gene clusters. The individual genes will have their own individual detection models (e.g. PHM, PVM, POM, etc.) while the GCM checks to see if all the component genes of the cluster have a Strict or Perfect hit and are ordered correctly within an operon. GCMs are encoded using the gene order parameter. This model type is still under development and not currently supported by the Resistance Gene Identifier (RGI) software. " 326 UPDATE OXA-225 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 352 UPDATE PDC-5 penam; carbapenem; cephalosporin; cefazolin; ampicillin; ceftazidime; cefalotin; cephamycin; antibiotic inactivation; PDC beta-lactamase; monobactam; cefixime; ceftriaxone; cefoxitin; ARO_category "DELETED 35981 " 5098 UPDATE OXA-793 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2877 UPDATE OXA-535 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2876 UPDATE OXA-436 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5099 UPDATE OXA-794 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 209 UPDATE AAC(3)-Ib/AAC(6')-Ib'' fusion protein antibiotic inactivation; kanamycin A; gentamicin; sisomicin; astromicin; aminoglycoside bifunctional resistance protein; amikacin; aminoglycoside antibiotic; tobramycin; ARO_description; ARO_category; ARO_name "UPDATED ARO_description with AAC(3)-Ib/AAC(6')-Ib3 is an integron-encoded aminoglycoside acetyltransferase in P. aeruginosa. DELETED 36484 UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with astromicin UPDATED category_aro_cvterm_id with 35922 UPDATED category_aro_accession with 0000003 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Astromicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Astromicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with aminoglycoside bifunctional resistance protein UPDATED category_aro_cvterm_id with 46171 UPDATED category_aro_accession with 3007419 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with Bifunctional aminoglycoside-inactivating enzymes composed of two separate functional domains. These proteins possess activity from both enzyme components, thereby conferring resistance to the combination of antibiotics from both domains, and may include acetylation, phosphorylation or nucleotidylation activity. UPDATED category_aro_name with amikacin UPDATED category_aro_cvterm_id with 35932 UPDATED category_aro_accession with 0000013 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Amikacin is an aminoglycoside antibiotic that works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). UPDATED ARO_name with AAC(3)-Ib/AAC(6')-Ib3 bifunctional protein " 4069 UPDATE OXA-647 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2878 UPDATE almG colistin B; colistin A; polymyxin resistance operon; peptide antibiotic; antibiotic target alteration; lipid A acyltransferase; ARO_category "DELETED 36593 UPDATED category_aro_name with colistin B UPDATED category_aro_cvterm_id with 36968 UPDATED category_aro_accession with 3000624 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Colistin B, or polymyxin E2, has a 6-heptanoic acid lipid tail. Polymyxins disrupt the cell membrane of Gram-negative bacteria. UPDATED category_aro_name with colistin A UPDATED category_aro_cvterm_id with 36966 UPDATED category_aro_accession with 3000622 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Colistin A, or polymyxin E1, has a 6-octanoic acid lipid tail. Polymyxins disrupt the cell membrane of Gram-negative bacteria. UPDATED category_aro_name with polymyxin resistance operon UPDATED category_aro_cvterm_id with 46184 UPDATED category_aro_accession with 3007428 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with Operon or gene clusters confering resistance to polymyxin antibiotics. " 779 UPDATE OXA-350 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1398 UPDATE OXA-108 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3356 UPDATE OXA-296 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 73 UPDATE OXA-35 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5065 UPDATE OXA-756 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4892 UPDATE OXA-563 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4835 UPDATE OXA-500 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4866 UPDATE OXA-531 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1570 UPDATE OprA antibiotic efflux; tobramycin; resistance-nodulation-cell division (RND) antibiotic efflux pump; efflux pump complex or subunit conferring antibiotic resistance; ofloxacin; norfloxacin; meropenem; macrolide antibiotic; carbapenem; gentamicin; arbekacin; ciprofloxacin; tetracycline antibiotic; gentamicin C; amikacin; aminoglycoside antibiotic; fluoroquinolone antibiotic; tetracycline; erythromycin; ARO_category "UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 834 UPDATE FosA3 fosfomycin; fosfomycin thiol transferase; antibiotic inactivation; phosphonic acid antibiotic; ARO_category "UPDATED category_aro_name with fosfomycin UPDATED category_aro_cvterm_id with 35944 UPDATED category_aro_accession with 0000025 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Fosfomycin (also known as phosphomycin and phosphonomycin) is a broad-spectrum antibiotic produced by certain Streptomyces species. It is effective on gram positive and negative bacteria as it targets the cell wall, an essential feature shared by both bacteria. Its specific target is MurA (MurZ in E.coli), which attaches phosphoenolpyruvate (PEP) to UDP-N-acetylglucosamine, a step of commitment to cell wall synthesis. In the active site of MurA, the active cysteine molecule is alkylated which stops the catalytic reaction. " 3527 UPDATE OXA-460 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 835 UPDATE APH(3')-Ib antibiotic inactivation; aminoglycoside antibiotic; gentamicin; lividomycin; paromomycin; kanamycin A; APH(3'); gentamicin B; ribostamycin; neomycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-phosphotransferase enzymes with modification regiospecificity based at the 3'-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics, specifically kanamycin and neomycin, by the ATP-dependent phosphorylation of the 3'-hydroxyl group of the compound. DELETED 36997 UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). UPDATED category_aro_name with lividomycin UPDATED category_aro_cvterm_id with 37002 UPDATED category_aro_accession with 3000658 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Lividomycins are aminoglycosidic antibiotics produced by Streptomyces lividus. They contain 2-amino-2,3-dideoxy-D-glucose. " 1341 UPDATE OXA-53 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5108 UPDATE OXA-803 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1681 UPDATE APH(4)-Ib antibiotic inactivation; hygromycin B; aminoglycoside antibiotic; APH(4); ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-phosphotransferase enzymes with modification regiospecificity based at the 4-hydroxyl group of the respective antibiotic. These enzymes are characterized by enzymatic antibiotic inactivation, specifically of hygromycin, by the ATP-dependent phosphorylation of the 4-hydroxyl group of the compound. " 1682 UPDATE aadA24 antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-nucleotidyltransferase enzymes with modification regiospecificity based at the 3''-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics by transfer of an AMP group from an ATP substrate to the 3''-hydroxyl group of the compound. " 3423 UPDATE OXA-185 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1686 UPDATE OXA-34 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1762 UPDATE aadA16 antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-nucleotidyltransferase enzymes with modification regiospecificity based at the 3''-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics by transfer of an AMP group from an ATP substrate to the 3''-hydroxyl group of the compound. " 2201 UPDATE PvrR penam; gentamicin; kanamycin A; phenotypic variant regulator; gentamicin A; carbenicillin; tetracycline antibiotic; resistance by absence; amikacin; aminoglycoside antibiotic; tetracycline; tobramycin; ARO_category "UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 1761 UPDATE OXA-351 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5167 UPDATE OXA-870 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1764 UPDATE OXA-97 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1765 UPDATE OXA-56 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1143 UPDATE OXA-7 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1269 UPDATE OXA-192 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1141 UPDATE OXA-169 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2180 UPDATE glycopeptide resistance gene cluster VanL glycopeptide antibiotic; glycopeptide resistance gene cluster; antibiotic target alteration; vancomycin; model_description "UPDATED model_description with Gene Cluster Meta-Models (GCM) are used to curate spatial clusters of individual genes within operons, such as for glycopeptide resistance gene clusters. The individual genes will have their own individual detection models (e.g. PHM, PVM, POM, etc.) while the GCM checks to see if all the component genes of the cluster have a Strict or Perfect hit and are ordered correctly within an operon. GCMs are encoded using the gene order parameter. This model type is still under development and not currently supported by the Resistance Gene Identifier (RGI) software. " 3498 UPDATE OXA-414 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3499 UPDATE OXA-416 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3496 UPDATE OXA-412 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3497 UPDATE OXA-413 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1148 UPDATE OXA-363 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3495 UPDATE OXA-411 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3492 UPDATE OXA-407 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3493 UPDATE OXA-408 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3490 UPDATE OXA-405 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3491 UPDATE OXA-406 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1911 UPDATE AAC(6')-Iad 2'-N-ethylnetilmicin; 5-episisomicin; AAC(6'); aminoglycoside antibiotic; sisomicin; antibiotic inactivation; netilmicin; amikacin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. UPDATED category_aro_name with amikacin UPDATED category_aro_cvterm_id with 35932 UPDATED category_aro_accession with 0000013 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Amikacin is an aminoglycoside antibiotic that works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with tobramycin UPDATED category_aro_cvterm_id with 35969 UPDATED category_aro_accession with 0000052 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Tobramycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Tobramycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. " 1221 UPDATE OXA-231 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2711 UPDATE MexXY-OprM erythromycin; tetracycline antibiotic; meropenem; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; ofloxacin; norfloxacin; macrolide antibiotic; carbapenem; cephalosporin; ciprofloxacin; gentamicin C; amikacin; aminoglycoside antibiotic; disinfecting agents and antiseptics; penam; gentamicin; efflux pump complex or subunit conferring antibiotic resistance; cephamycin; acriflavine; fluoroquinolone antibiotic; chloramphenicol; phenicol antibiotic; tetracycline; tobramycin; ARO_category "UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 2091 UPDATE Mycobacteroides chelonae 16S rRNA mutation conferring resistance to gentamicin C antibiotic target alteration; aminoglycoside antibiotic; gentamicin C; gentamicin; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; ARO_category "UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 653 UPDATE AAC(3)-VIIa antibiotic inactivation; AAC(3); aminoglycoside antibiotic; paromomycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 3-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 3-amino group of the compound. " 3286 UPDATE Klebsiella pneumoniae KpnF peptide antibiotic; triclosan; rifampin; small multidrug resistance (SMR) antibiotic efflux pump; antibiotic efflux; aminoglycoside antibiotic; rifamycin antibiotic; colistin A; macrolide antibiotic; colistin B; efflux pump complex or subunit conferring antibiotic resistance; cephalosporin; cefepime; benzalkonium chloride; tetracycline antibiotic; chlorhexidine; streptomycin; ceftriaxone; disinfecting agents and antiseptics; tetracycline; erythromycin; ARO_category "DELETED 36003 UPDATED category_aro_name with small multidrug resistance (SMR) antibiotic efflux pump UPDATED category_aro_cvterm_id with 36004 UPDATED category_aro_accession with 0010003 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with Directed pumping of antibiotic out of a cell to confer resistance. Small multidrug resistance (SMR) proteins are a relatively small family of transporters, restricted to prokaryotic cells. They are also the smallest multidrug transporters, with only four transmembrane alpha-helices and no significant extramembrane domain. " 3654 UPDATE Neisseria gonorrhoeae gyrB conferring resistance to zoliflodacin antibiotic target alteration; Zoliflodacin; Zoliflodacin resistant gyrB; zoliflodacin-like antibiotic; ARO_category "UPDATED category_aro_name with Zoliflodacin UPDATED category_aro_cvterm_id with 42994 UPDATED category_aro_accession with 3004858 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Experimental antibiotic in phase two trial for Neisseria gonorrhoeae treatment. " 3653 UPDATE SCO-1 penam; cefalotin; antibiotic inactivation; penem; cephalosporin; cefotaxime; ceftazidime; cefepime; penicillin; ticarcillin; amoxicillin; cefuroxime; SCO beta-lactamase; piperacillin; ARO_category "DELETED 35996 " 2525 UPDATE AAC(6')-34 AAC(6'); kanamycin A; antibiotic inactivation; aminoglycoside antibiotic; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. " 693 UPDATE OXA-22 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 690 UPDATE OXA-347 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 947 UPDATE OXA-100 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1540 UPDATE rmtC kanamycin A; aminoglycoside antibiotic; isepamicin; gentamicin; 16S rRNA methyltransferase (G1405); sisomicin; arbekacin; gentamicin B; netilmicin; antibiotic target alteration; gentamicin C; amikacin; dibekacin; G418; tobramycin; ARO_category "UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 2138 UPDATE NmcA penam; carbapenem; NmcA beta-lactamase; cefazolin; cephalosporin; antibiotic inactivation; cephamycin; ampicillin; cefoxitin; ARO_category "DELETED 35981 " 4901 UPDATE OXA-575 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4900 UPDATE OXA-574 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4903 UPDATE OXA-577 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4902 UPDATE OXA-576 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4905 UPDATE OXA-579 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4904 UPDATE OXA-578 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1548 UPDATE APH(3')-Vb antibiotic inactivation; aminoglycoside antibiotic; paromomycin; APH(3'); ribostamycin; neomycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-phosphotransferase enzymes with modification regiospecificity based at the 3'-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics, specifically kanamycin and neomycin, by the ATP-dependent phosphorylation of the 3'-hydroxyl group of the compound. DELETED 36997 " 4906 UPDATE OXA-580 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5095 UPDATE OXA-787 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 639 UPDATE AAC(3)-IV 2'-N-ethylnetilmicin; antibiotic inactivation; AAC(3); aminoglycoside antibiotic; gentamicin; 6'-N-ethylnetilmicin; sisomicin; netilmicin; apramycin; dibekacin; tobramycin; CARD_short_name; ARO_category; model_name; ARO_name "UPDATED CARD_short_name with AAC(3)-IVa UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 3-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 3-amino group of the compound. DELETED 40307 UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). UPDATED category_aro_name with 6'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46127 UPDATED category_aro_accession with 3007377 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 6'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with tobramycin UPDATED category_aro_cvterm_id with 35969 UPDATED category_aro_accession with 0000052 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Tobramycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Tobramycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED model_name with AAC(3)-IVa UPDATED ARO_name with AAC(3)-IVa " 5104 UPDATE OXA-799 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 544 UPDATE AAC(6')-Is 2'-N-ethylnetilmicin; 5-episisomicin; AAC(6'); aminoglycoside antibiotic; sisomicin; antibiotic inactivation; netilmicin; amikacin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. DELETED 35966 UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. " 4064 UPDATE OXA-895 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1464 UPDATE aadA7 antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-nucleotidyltransferase enzymes with modification regiospecificity based at the 3''-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics by transfer of an AMP group from an ATP substrate to the 3''-hydroxyl group of the compound. " 5105 UPDATE OXA-800 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1460 UPDATE FosB3 fosfomycin; fosfomycin thiol transferase; antibiotic inactivation; phosphonic acid antibiotic; ARO_category "UPDATED category_aro_name with fosfomycin UPDATED category_aro_cvterm_id with 35944 UPDATED category_aro_accession with 0000025 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Fosfomycin (also known as phosphomycin and phosphonomycin) is a broad-spectrum antibiotic produced by certain Streptomyces species. It is effective on gram positive and negative bacteria as it targets the cell wall, an essential feature shared by both bacteria. Its specific target is MurA (MurZ in E.coli), which attaches phosphoenolpyruvate (PEP) to UDP-N-acetylglucosamine, a step of commitment to cell wall synthesis. In the active site of MurA, the active cysteine molecule is alkylated which stops the catalytic reaction. " 1040 UPDATE OXA-95 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4888 UPDATE OXA-559 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5064 UPDATE OXA-755 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5067 UPDATE OXA-758 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5066 UPDATE OXA-757 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5061 UPDATE OXA-752 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1312 UPDATE OXA-111 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5148 UPDATE OXA-851 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5149 UPDATE OXA-852 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4880 UPDATE OXA-551 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4881 UPDATE OXA-552 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4882 UPDATE OXA-553 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5145 UPDATE OXA-847 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5069 UPDATE OXA-760 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5068 UPDATE OXA-759 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4886 UPDATE OXA-557 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4887 UPDATE OXA-558 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 120 UPDATE aadA4 antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-nucleotidyltransferase enzymes with modification regiospecificity based at the 3''-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics by transfer of an AMP group from an ATP substrate to the 3''-hydroxyl group of the compound. " 3403 UPDATE Mycobacterium tuberculosis rpsA mutations conferring resistance to pyrazinamide antibiotic target alteration; pyrazinamide resistant rpsA; pyrazinamide; pyrazine antibiotic; ARO_category "UPDATED category_aro_name with pyrazinamide UPDATED category_aro_cvterm_id with 39997 UPDATED category_aro_accession with 3003413 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Pyrazinamide is an antimycobacterial. It is highly specific and active only against Mycobacterium tuberculosis. This compound is a prodrug and needs to be activated inside the cell. It interferes with the bacterium's ability to synthesize new fatty acids, causing cell death. " 3405 UPDATE OXA-402 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 218 UPDATE npmA aminoglycoside antibiotic; gentamicin; 16S rRNA methyltransferase (A1408); neomycin; antibiotic target alteration; amikacin; ribostamycin; gentamicin A; ARO_category "UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 3407 UPDATE OXA-103 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3406 UPDATE OXA-140 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3409 UPDATE OXA-123 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3408 UPDATE OXA-122 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4875 UPDATE OXA-546 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4874 UPDATE OXA-545 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4877 UPDATE OXA-548 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4876 UPDATE OXA-547 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4871 UPDATE OXA-537 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4870 UPDATE OXA-536 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4873 UPDATE OXA-542 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4872 UPDATE OXA-538 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1825 UPDATE CTX-M-27 penam; carbapenem; cephalosporin; cefazolin; ceftazidime; cefalotin; ampicillin; antibiotic inactivation; cefixime; CTX-M beta-lactamase; ertapenem; ARO_category "DELETED 40951 " 1821 UPDATE AAC(6')-Ir 2'-N-ethylnetilmicin; 5-episisomicin; AAC(6'); aminoglycoside antibiotic; sisomicin; antibiotic inactivation; netilmicin; amikacin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. DELETED 35966 UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. " 4878 UPDATE OXA-549 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 414 UPDATE OXA-377 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3445 UPDATE OXA-280 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 416 UPDATE OXA-204 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3415 UPDATE OXA-151 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4978 UPDATE OXA-658 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4979 UPDATE OXA-659 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 412 UPDATE OXA-117 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 413 UPDATE OXA-144 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4974 UPDATE OXA-654 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4975 UPDATE OXA-655 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4976 UPDATE OXA-656 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4977 UPDATE OXA-657 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4970 UPDATE OXA-645 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4971 UPDATE OXA-650 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1382 UPDATE rmtG gentamicin; 16S rRNA methyltransferase (G1405); arbekacin; antibiotic target alteration; amikacin; aminoglycoside antibiotic; gentamicin A; tobramycin; ARO_category "UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 4973 UPDATE OXA-652 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3827 UPDATE OXA-898 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3826 UPDATE OXA-899 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 319 UPDATE OXA-366 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 318 UPDATE OXA-358 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1059 UPDATE APH(9)-Ib antibiotic inactivation; aminoglycoside antibiotic; APH(9); spectinomycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-phosphotransferase enzymes with modification regiospecificity based at the 9-hydroxyl group of the respective antibiotic. These enzymes are characterized by enzymatic antibiotic inactivation, specifically of spectinomycin, by the ATP-dependent phosphorylation of the 9-hydroxyl group of the compound. " 5002 UPDATE OXA-690 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 313 UPDATE OXA-143 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3441 UPDATE OXA-275 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3944 UPDATE OXA-544 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1923 UPDATE APH(3'')-Ia antibiotic inactivation; APH(3''); streptomycin; aminoglycoside antibiotic; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-phosphotransferase enzymes with modification regiospecificity based at the 3''-hydroxyl group of the respective antibiotic. These enzymes are characterized by enzymatic antibiotic inactivation, specifically of streptomycin, by the ATP-dependent phosphorylation of the 3''-hydroxyl group of the compound. DELETED 40307 " 867 UPDATE OXA-175 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1928 UPDATE OXA-50 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; ampicillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 475 UPDATE OXA-106 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3474 UPDATE OXA-340 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3475 UPDATE OXA-341 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3476 UPDATE OXA-342 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 497 UPDATE OXA-79 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3470 UPDATE OXA-308 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3471 UPDATE OXA-336 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3472 UPDATE OXA-337 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3473 UPDATE OXA-339 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5090 UPDATE OXA-782 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5091 UPDATE OXA-783 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5092 UPDATE OXA-784 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5093 UPDATE OXA-785 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3478 UPDATE OXA-344 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3479 UPDATE OXA-345 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5096 UPDATE OXA-788 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5097 UPDATE OXA-789 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1365 UPDATE AAC(6')-I30 2'-N-ethylnetilmicin; 5-episisomicin; AAC(6'); aminoglycoside antibiotic; sisomicin; antibiotic inactivation; netilmicin; amikacin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. DELETED 40942 UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. UPDATED category_aro_name with amikacin UPDATED category_aro_cvterm_id with 35932 UPDATED category_aro_accession with 0000013 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Amikacin is an aminoglycoside antibiotic that works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with tobramycin UPDATED category_aro_cvterm_id with 35969 UPDATED category_aro_accession with 0000052 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Tobramycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Tobramycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. " 5689 UPDATE VHH-1 antibiotic inactivation; penam; carbapenem; cephalosporin; VHH beta-lactamase; ampicillin; ARO_category "UPDATED category_aro_name with penam UPDATED category_aro_cvterm_id with 36017 UPDATED category_aro_accession with 3000008 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_name with ampicillin UPDATED category_aro_cvterm_id with 36981 UPDATED category_aro_accession with 3000637 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Ampicillin is a penicillin derivative that is highly acid stable, with its activity similar to benzylpenicillin. " 5074 UPDATE OXA-765 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3841 UPDATE AAC(6')-Ib-cr4 antibiotic inactivation; AAC(6')-Ib-cr; AAC(6'); kanamycin A; ciprofloxacin; fluoroquinolone antibiotic; amikacin; aminoglycoside antibiotic; tobramycin; ARO_category "UPDATED category_aro_name with AAC(6') UPDATED category_aro_cvterm_id with 36484 UPDATED category_aro_accession with 3000345 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. " 3419 UPDATE OXA-155 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 441 UPDATE OXA-54 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 360 UPDATE AAC(6')-Iy 2'-N-ethylnetilmicin; 5-episisomicin; AAC(6'); aminoglycoside antibiotic; sisomicin; antibiotic inactivation; netilmicin; amikacin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. UPDATED category_aro_name with amikacin UPDATED category_aro_cvterm_id with 35932 UPDATED category_aro_accession with 0000013 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Amikacin is an aminoglycoside antibiotic that works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with tobramycin UPDATED category_aro_cvterm_id with 35969 UPDATED category_aro_accession with 0000052 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Tobramycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Tobramycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. " 361 UPDATE OXA-278 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 440 UPDATE MexA sulfonamide antibiotic; penem; panipenem; tetracycline antibiotic; meropenem; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; aztreonam; trimethoprim; aminocoumarin antibiotic; cephalosporin; macrolide antibiotic; carbapenem; ceftazidime; ciprofloxacin; cephamycin; ceftriaxone; colistin B; colistin A; peptide antibiotic; diaminopyrimidine antibiotic; ticarcillin; ampicillin; penam; sulfamethoxazole; novobiocin; phenicol antibiotic; efflux pump complex or subunit conferring antibiotic resistance; trimethoprim-sulfamethoxazole; tetracycline; monobactam; fluoroquinolone antibiotic; erythromycin; nalidixic acid; azithromycin; chloramphenicol; ARO_category "DELETED 35996 " 2019 UPDATE OXA-213 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2023 UPDATE OXA-132 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 902 UPDATE OXA-92 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3319 UPDATE AAC(6')-Ian 2'-N-ethylnetilmicin; 5-episisomicin; AAC(6'); aminoglycoside antibiotic; sisomicin; antibiotic inactivation; netilmicin; amikacin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. DELETED 35966 UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. " 4850 UPDATE OXA-515 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 384 UPDATE APH(2'')-IVa antibiotic inactivation; gentamicin; kanamycin A; APH(2''); amikacin; aminoglycoside antibiotic; gentamicin A; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-phosphotransferase enzymes with modification regiospecificity based at the 2''-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics, specifically kanamycin, tobramycin and amikacin, by the ATP-dependent phosphorylation of the 3'-hydroxyl group of the compound. DELETED 35953 UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 385 UPDATE OXA-46 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5133 UPDATE OXA-831 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3799 UPDATE LptD antibiotic efflux; ATP-binding cassette (ABC) antibiotic efflux pump; aminocoumarin antibiotic; peptide antibiotic; efflux pump complex or subunit conferring antibiotic resistance; rifamycin antibiotic; ARO_description; ARO_category "UPDATED ARO_description with LptD is involved in LPS transport in a ABC Transporter efflux system. It confers resistance to rifamycin, aminocoumarin, and peptide antibiotics. DELETED 35939 " 444 UPDATE AAC(6')-Ib-Suzhou antibiotic inactivation; AAC(6'); kanamycin A; amikacin; aminoglycoside antibiotic; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. UPDATED category_aro_name with kanamycin A UPDATED category_aro_cvterm_id with 35966 UPDATED category_aro_accession with 0000049 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Kanamycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Kanamycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with amikacin UPDATED category_aro_cvterm_id with 35932 UPDATED category_aro_accession with 0000013 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Amikacin is an aminoglycoside antibiotic that works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with tobramycin UPDATED category_aro_cvterm_id with 35969 UPDATED category_aro_accession with 0000052 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Tobramycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Tobramycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. " 1925 UPDATE MexB sulfonamide antibiotic; penem; panipenem; tetracycline antibiotic; meropenem; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; aztreonam; trimethoprim; aminocoumarin antibiotic; cephalosporin; macrolide antibiotic; carbapenem; ceftazidime; ciprofloxacin; cephamycin; ceftriaxone; colistin B; colistin A; peptide antibiotic; diaminopyrimidine antibiotic; ticarcillin; ampicillin; penam; sulfamethoxazole; novobiocin; phenicol antibiotic; efflux pump complex or subunit conferring antibiotic resistance; trimethoprim-sulfamethoxazole; tetracycline; monobactam; fluoroquinolone antibiotic; erythromycin; nalidixic acid; azithromycin; chloramphenicol; ARO_category "DELETED 35996 " 4056 UPDATE OXA-570 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4055 UPDATE OXA-926 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4054 UPDATE OXA-835 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4053 UPDATE OXA-541 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4052 UPDATE OXA-737 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1728 UPDATE OXA-42 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4050 UPDATE OXA-543 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1079 UPDATE OXA-161 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4057 UPDATE OXA-573 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4059 UPDATE OXA-672 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4058 UPDATE OXA-571 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 924 UPDATE AAC(6')-33 AAC(6'); antibiotic inactivation; amikacin; aminoglycoside antibiotic; tobramycin; ARO_description; CARD_short_name; ARO_category; model_name; ARO_name "UPDATED ARO_description with AAC(6')-I33 is an integron-encoded aminoglycoside acetyltransferase in P. aeruginosa. UPDATED CARD_short_name with AAC(6')-I33 UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. UPDATED category_aro_name with amikacin UPDATED category_aro_cvterm_id with 35932 UPDATED category_aro_accession with 0000013 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Amikacin is an aminoglycoside antibiotic that works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with tobramycin UPDATED category_aro_cvterm_id with 35969 UPDATED category_aro_accession with 0000052 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Tobramycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Tobramycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED model_name with AAC(6')-I33 UPDATED ARO_name with AAC(6')-I33 " 1077 UPDATE OXA-420 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3477 UPDATE OXA-343 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3759 UPDATE APH(3')-VIb antibiotic inactivation; aminoglycoside antibiotic; isepamicin; gentamicin; paromomycin; kanamycin A; APH(3'); gentamicin B; amikacin; ribostamycin; neomycin; butirosin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-phosphotransferase enzymes with modification regiospecificity based at the 3'-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics, specifically kanamycin and neomycin, by the ATP-dependent phosphorylation of the 3'-hydroxyl group of the compound. DELETED 36997 UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 3758 UPDATE VMB-1 penam; carbapenem; imipenem; cefotaxime; VMB beta-lactamase; cephalosporin; antibiotic inactivation; ampicillin; amoxicillin; ceftriaxone; meropenem; ARO_category "UPDATED category_aro_name with penam UPDATED category_aro_cvterm_id with 36017 UPDATED category_aro_accession with 3000008 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_name with imipenem UPDATED category_aro_cvterm_id with 36309 UPDATED category_aro_accession with 3000170 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Imipenem is a broad-spectrum antibiotic and is usually taken with cilastatin, which prevents hydrolysis of imipenem by renal dehydropeptidase-I. It is resistant to hydrolysis by most other beta-lactamases. Notable exceptions are the KPC beta-lactamases and Ambler Class B enzymes. UPDATED category_aro_name with cefotaxime UPDATED category_aro_cvterm_id with 36989 UPDATED category_aro_accession with 3000645 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefotaxime is a semisynthetic cephalosporin taken parenterally. It is resistant to most beta-lactamases and active against Gram-negative rods and cocci due to its aminothiazoyl and methoximino functional groups. UPDATED category_aro_name with cephalosporin UPDATED category_aro_cvterm_id with 35951 UPDATED category_aro_accession with 0000032 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_name with ampicillin UPDATED category_aro_cvterm_id with 36981 UPDATED category_aro_accession with 3000637 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Ampicillin is a penicillin derivative that is highly acid stable, with its activity similar to benzylpenicillin. UPDATED category_aro_name with amoxicillin UPDATED category_aro_cvterm_id with 35981 UPDATED category_aro_accession with 0000064 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Amoxicillin is a moderate-spectrum, bacteriolytic, beta-lactam antibiotic used to treat bacterial infections caused by susceptible microorganisms. A derivative of penicillin, it has a wider range of treatment but remains relatively ineffective against Gram-negative bacteria. It is commonly taken with clavulanic acid, a beta-lactamase inhibitor. Like other beta-lactams, amoxicillin interferes with the synthesis of peptidoglycan. UPDATED category_aro_name with ceftriaxone UPDATED category_aro_cvterm_id with 35979 UPDATED category_aro_accession with 0000062 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Ceftriaxone is a third-generation cephalosporin antibiotic. The presence of an aminothiazolyl sidechain increases ceftriazone's resistance to beta-lactamases. Like other third-generation cephalosporins, it has broad spectrum activity against Gram-positive and Gram-negative bacteria. UPDATED category_aro_name with meropenem UPDATED category_aro_cvterm_id with 35990 UPDATED category_aro_accession with 0000073 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Meropenem is an ultra-broad spectrum injectable antibiotic used to treat a wide variety of infections, including meningitis and pneumonia. It is a beta-lactam and belongs to the subgroup of carbapenem, similar to imipenem and ertapenem. " 573 UPDATE OXA-136 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 572 UPDATE OXA-137 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2291 UPDATE Chlamydia trachomatis intrinsic murA conferring resistance to fosfomycin fosfomycin; phosphonic acid antibiotic; antibiotic target alteration; antibiotic-resistant murA transferase; ARO_category "UPDATED category_aro_name with fosfomycin UPDATED category_aro_cvterm_id with 35944 UPDATED category_aro_accession with 0000025 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Fosfomycin (also known as phosphomycin and phosphonomycin) is a broad-spectrum antibiotic produced by certain Streptomyces species. It is effective on gram positive and negative bacteria as it targets the cell wall, an essential feature shared by both bacteria. Its specific target is MurA (MurZ in E.coli), which attaches phosphoenolpyruvate (PEP) to UDP-N-acetylglucosamine, a step of commitment to cell wall synthesis. In the active site of MurA, the active cysteine molecule is alkylated which stops the catalytic reaction. " 2290 UPDATE Mycobacterium tuberculosis intrinsic murA conferring resistance to fosfomycin fosfomycin; phosphonic acid antibiotic; antibiotic target alteration; antibiotic-resistant murA transferase; ARO_category "UPDATED category_aro_name with fosfomycin UPDATED category_aro_cvterm_id with 35944 UPDATED category_aro_accession with 0000025 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Fosfomycin (also known as phosphomycin and phosphonomycin) is a broad-spectrum antibiotic produced by certain Streptomyces species. It is effective on gram positive and negative bacteria as it targets the cell wall, an essential feature shared by both bacteria. Its specific target is MurA (MurZ in E.coli), which attaches phosphoenolpyruvate (PEP) to UDP-N-acetylglucosamine, a step of commitment to cell wall synthesis. In the active site of MurA, the active cysteine molecule is alkylated which stops the catalytic reaction. " 4861 UPDATE OXA-526 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 575 UPDATE AAC(3)-Ib antibiotic inactivation; AAC(3); gentamicin; sisomicin; astromicin; aminoglycoside antibiotic; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 3-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 3-amino group of the compound. DELETED 35966 UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with astromicin UPDATED category_aro_cvterm_id with 35922 UPDATED category_aro_accession with 0000003 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Astromicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Astromicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 574 UPDATE AAC(6')-Ia 2'-N-ethylnetilmicin; 5-episisomicin; AAC(6'); aminoglycoside antibiotic; sisomicin; antibiotic inactivation; netilmicin; amikacin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. DELETED 35966 UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. " 2191 UPDATE AAC(6')-Iaj 2'-N-ethylnetilmicin; 5-episisomicin; AAC(6'); aminoglycoside antibiotic; sisomicin; antibiotic inactivation; netilmicin; amikacin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. UPDATED category_aro_name with amikacin UPDATED category_aro_cvterm_id with 35932 UPDATED category_aro_accession with 0000013 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Amikacin is an aminoglycoside antibiotic that works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with tobramycin UPDATED category_aro_cvterm_id with 35969 UPDATED category_aro_accession with 0000052 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Tobramycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Tobramycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. " 258 UPDATE OXA-208 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 63 UPDATE AAC(6')-Ib antibiotic inactivation; AAC(6'); kanamycin A; amikacin; aminoglycoside antibiotic; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. DELETED 40307 UPDATED category_aro_name with kanamycin A UPDATED category_aro_cvterm_id with 35966 UPDATED category_aro_accession with 0000049 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Kanamycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Kanamycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with amikacin UPDATED category_aro_cvterm_id with 35932 UPDATED category_aro_accession with 0000013 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Amikacin is an aminoglycoside antibiotic that works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. " 67 UPDATE OXA-391 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 252 UPDATE APH(9)-Ia antibiotic inactivation; aminoglycoside antibiotic; APH(9); spectinomycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-phosphotransferase enzymes with modification regiospecificity based at the 9-hydroxyl group of the respective antibiotic. These enzymes are characterized by enzymatic antibiotic inactivation, specifically of spectinomycin, by the ATP-dependent phosphorylation of the 9-hydroxyl group of the compound. DELETED 40307 " 69 UPDATE aadA23 antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-nucleotidyltransferase enzymes with modification regiospecificity based at the 3''-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics by transfer of an AMP group from an ATP substrate to the 3''-hydroxyl group of the compound. " 251 UPDATE APH(3')-VIIa kanamycin A; APH(3'); antibiotic inactivation; aminoglycoside antibiotic; neomycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-phosphotransferase enzymes with modification regiospecificity based at the 3'-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics, specifically kanamycin and neomycin, by the ATP-dependent phosphorylation of the 3'-hydroxyl group of the compound. DELETED 36997 " 254 UPDATE OXA-150 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4981 UPDATE OXA-661 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2202 UPDATE AAC(3)-Ib/AAC(6')-Ib'' fusion protein antibiotic inactivation; kanamycin A; gentamicin; sisomicin; astromicin; aminoglycoside bifunctional resistance protein; amikacin; aminoglycoside antibiotic; tobramycin; ARO_description; ARO_category; ARO_name "UPDATED ARO_description with AAC(3)-Ib/AAC(6')-Ib3 is an integron-encoded aminoglycoside acetyltransferase in P. aeruginosa. DELETED 36484 UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with astromicin UPDATED category_aro_cvterm_id with 35922 UPDATED category_aro_accession with 0000003 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Astromicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Astromicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with aminoglycoside bifunctional resistance protein UPDATED category_aro_cvterm_id with 46171 UPDATED category_aro_accession with 3007419 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with Bifunctional aminoglycoside-inactivating enzymes composed of two separate functional domains. These proteins possess activity from both enzyme components, thereby conferring resistance to the combination of antibiotics from both domains, and may include acetylation, phosphorylation or nucleotidylation activity. UPDATED category_aro_name with amikacin UPDATED category_aro_cvterm_id with 35932 UPDATED category_aro_accession with 0000013 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Amikacin is an aminoglycoside antibiotic that works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). UPDATED ARO_name with AAC(3)-Ib/AAC(6')-Ib3 bifunctional protein " 3369 UPDATE FosB1 fosfomycin; fosfomycin thiol transferase; antibiotic inactivation; phosphonic acid antibiotic; ARO_category "UPDATED category_aro_name with fosfomycin UPDATED category_aro_cvterm_id with 35944 UPDATED category_aro_accession with 0000025 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Fosfomycin (also known as phosphomycin and phosphonomycin) is a broad-spectrum antibiotic produced by certain Streptomyces species. It is effective on gram positive and negative bacteria as it targets the cell wall, an essential feature shared by both bacteria. Its specific target is MurA (MurZ in E.coli), which attaches phosphoenolpyruvate (PEP) to UDP-N-acetylglucosamine, a step of commitment to cell wall synthesis. In the active site of MurA, the active cysteine molecule is alkylated which stops the catalytic reaction. " 1370 UPDATE AAC(6')-Ib10 antibiotic inactivation; AAC(6'); kanamycin A; amikacin; aminoglycoside antibiotic; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. UPDATED category_aro_name with kanamycin A UPDATED category_aro_cvterm_id with 35966 UPDATED category_aro_accession with 0000049 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Kanamycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Kanamycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with amikacin UPDATED category_aro_cvterm_id with 35932 UPDATED category_aro_accession with 0000013 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Amikacin is an aminoglycoside antibiotic that works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with tobramycin UPDATED category_aro_cvterm_id with 35969 UPDATED category_aro_accession with 0000052 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Tobramycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Tobramycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. " 2181 UPDATE glycopeptide resistance gene cluster VanF glycopeptide antibiotic; glycopeptide resistance gene cluster; antibiotic target alteration; vancomycin; model_description "UPDATED model_description with Gene Cluster Meta-Models (GCM) are used to curate spatial clusters of individual genes within operons, such as for glycopeptide resistance gene clusters. The individual genes will have their own individual detection models (e.g. PHM, PVM, POM, etc.) while the GCM checks to see if all the component genes of the cluster have a Strict or Perfect hit and are ordered correctly within an operon. GCMs are encoded using the gene order parameter. This model type is still under development and not currently supported by the Resistance Gene Identifier (RGI) software. " 4983 UPDATE OXA-666 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 730 UPDATE AAC(6')-IIc 2'-N-ethylnetilmicin; 5-episisomicin; AAC(6'); aminoglycoside antibiotic; gentamicin; sisomicin; antibiotic inactivation; netilmicin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. DELETED 35966 UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. " 4883 UPDATE OXA-554 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 404 UPDATE OXA-217 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 735 UPDATE TEM-30 penam; antibiotic inactivation; amoxicillin; penem; cephalosporin; cefalotin; monobactam; ampicillin; TEM beta-lactamase; ARO_category "DELETED 35996 " 1032 UPDATE OXA-365 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 782 UPDATE OXA-63 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1031 UPDATE APH(6)-Id antibiotic inactivation; APH(6); streptomycin; aminoglycoside antibiotic; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-phosphotransferase enzymes with modification regiospecificity based at the 6-hydroxyl group of the respective antibiotic. These enzymes are characterized by enzymatic antibiotic inactivation, specifically of streptomycin, by the ATP-dependent phosphorylation of the 6-hydroxyl group of the compound. " 502 UPDATE aadA17 antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-nucleotidyltransferase enzymes with modification regiospecificity based at the 3''-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics by transfer of an AMP group from an ATP substrate to the 3''-hydroxyl group of the compound. " 500 UPDATE OXA-164 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 501 UPDATE AAC(3)-VIIIa antibiotic inactivation; AAC(3); aminoglycoside antibiotic; neomycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 3-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 3-amino group of the compound. " 5029 UPDATE OXA-717 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1213 UPDATE nalD sulfonamide antibiotic; penem; panipenem; tetracycline antibiotic; meropenem; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; aztreonam; trimethoprim; aminocoumarin antibiotic; cephalosporin; macrolide antibiotic; carbapenem; ceftazidime; ciprofloxacin; cephamycin; ceftriaxone; colistin B; protein(s) and two-component regulatory system modulating antibiotic efflux; colistin A; peptide antibiotic; diaminopyrimidine antibiotic; ticarcillin; ampicillin; penam; sulfamethoxazole; novobiocin; phenicol antibiotic; efflux pump complex or subunit conferring antibiotic resistance; trimethoprim-sulfamethoxazole; tetracycline; monobactam; fluoroquinolone antibiotic; erythromycin; nalidixic acid; azithromycin; chloramphenicol; ARO_category "DELETED 35996 " 1359 UPDATE OXA-233 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 633 UPDATE OXA-355 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5751 UPDATE OXA-290 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1217 UPDATE OXA-139 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 903 UPDATE APH(2'')-Ig antibiotic inactivation; gentamicin; kanamycin A; APH(2''); amikacin; aminoglycoside antibiotic; gentamicin A; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-phosphotransferase enzymes with modification regiospecificity based at the 2''-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics, specifically kanamycin, tobramycin and amikacin, by the ATP-dependent phosphorylation of the 3'-hydroxyl group of the compound. DELETED 35953 UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 5021 UPDATE OXA-709 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5020 UPDATE OXA-708 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5023 UPDATE OXA-711 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5022 UPDATE OXA-710 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5025 UPDATE OXA-713 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4811 UPDATE OXA-114k penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5027 UPDATE OXA-715 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1169 UPDATE OXA-360 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4884 UPDATE OXA-555 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4862 UPDATE OXA-527 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 38 UPDATE APH(3')-Va antibiotic inactivation; aminoglycoside antibiotic; paromomycin; APH(3'); ribostamycin; neomycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-phosphotransferase enzymes with modification regiospecificity based at the 3'-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics, specifically kanamycin and neomycin, by the ATP-dependent phosphorylation of the 3'-hydroxyl group of the compound. DELETED 36997 " 5152 UPDATE OXA-855 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4988 UPDATE OXA-675 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1641 UPDATE OXA-203 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3727 UPDATE Mycobacterium tuberculosis mshA mutations conferring resistance to isoniazid isoniazid; antibiotic target alteration; isoniazid-like antibiotic; isoniazid resistant mshA; ARO_category "UPDATED category_aro_name with isoniazid UPDATED category_aro_cvterm_id with 36659 UPDATED category_aro_accession with 3000520 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Isoniazid is an organic compound that is the first-line anti tuberculosis medication in prevention and treatment. As a prodrug, it is activated by mycobacterial catalase-peroxidases such as M. tuberculosis KatG. Isoniazid inhibits mycolic acid synthesis, which prevents cell wall synthesis in mycobacteria. " 160 UPDATE OXA-236 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4860 UPDATE OXA-525 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4816 UPDATE OXA-114q penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 964 UPDATE OXA-129 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4838 UPDATE OXA-503 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4932 UPDATE OXA-606 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4933 UPDATE OXA-607 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4934 UPDATE OXA-608 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 904 UPDATE rmtB kanamycin A; aminoglycoside antibiotic; isepamicin; gentamicin; 16S rRNA methyltransferase (G1405); sisomicin; arbekacin; gentamicin B; netilmicin; antibiotic target alteration; gentamicin C; amikacin; dibekacin; G418; tobramycin; ARO_category "UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 962 UPDATE OXA-356 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4937 UPDATE OXA-611 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4831 UPDATE OXA-493 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4830 UPDATE OXA-491 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4833 UPDATE OXA-497 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4814 UPDATE OXA-114n penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4812 UPDATE OXA-114l penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4834 UPDATE OXA-498 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4885 UPDATE OXA-556 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4836 UPDATE OXA-501 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1106 UPDATE NDM-5 penam; antibiotic inactivation; cephalosporin; carbapenem; ceftazidime; NDM beta-lactamase; cephamycin; cefoxitin; ertapenem; ARO_category "DELETED 40951 " 1105 UPDATE AAC(3)-VIa antibiotic inactivation; AAC(3); gentamicin; 6'-N-ethylnetilmicin; sisomicin; aminoglycoside antibiotic; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 3-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 3-amino group of the compound. DELETED 35933 UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). UPDATED category_aro_name with 6'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46127 UPDATED category_aro_accession with 3007377 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 6'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. " 4864 UPDATE OXA-529 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1100 UPDATE OXA-245 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1517 UPDATE OXA-33 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4865 UPDATE OXA-530 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1511 UPDATE OXA-423 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1841 UPDATE OXA-76 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1660 UPDATE OXA-375 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 783 UPDATE NDM-1 penam; antibiotic inactivation; imipenem; carbapenem; cephalosporin; NDM beta-lactamase; cephamycin; ertapenem; meropenem; ARO_category "DELETED 35981 " 5115 UPDATE OXA-810 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5114 UPDATE OXA-809 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5117 UPDATE OXA-813 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5116 UPDATE OXA-811 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5111 UPDATE OXA-806 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5110 UPDATE OXA-805 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5113 UPDATE OXA-808 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5112 UPDATE OXA-807 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3862 UPDATE OXA-906 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5119 UPDATE OXA-815 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5118 UPDATE OXA-814 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2913 UPDATE OXA-286 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3864 UPDATE OXA-850 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3531 UPDATE OXA-466 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3530 UPDATE OXA-465 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3533 UPDATE OXA-471 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3532 UPDATE OXA-470 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3535 UPDATE OXA-473 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3534 UPDATE OXA-472 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3537 UPDATE OXA-475 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3536 UPDATE OXA-474 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3539 UPDATE OXA-477 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3538 UPDATE OXA-476 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5056 UPDATE OXA-747 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5057 UPDATE OXA-748 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5050 UPDATE OXA-741 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5051 UPDATE OXA-742 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5052 UPDATE OXA-743 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5053 UPDATE OXA-744 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1814 UPDATE AAC(6')-Ie-APH(2'')-Ia bifunctional protein 2'-N-ethylnetilmicin; kanamycin A; 5-episisomicin; aminoglycoside antibiotic; gentamicin; sisomicin; antibiotic inactivation; netilmicin; aminoglycoside bifunctional resistance protein; amikacin; dibekacin; gentamicin A; tobramycin; ARO_category "DELETED 36267 UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). UPDATED category_aro_name with aminoglycoside bifunctional resistance protein UPDATED category_aro_cvterm_id with 46171 UPDATED category_aro_accession with 3007419 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with Bifunctional aminoglycoside-inactivating enzymes composed of two separate functional domains. These proteins possess activity from both enzyme components, thereby conferring resistance to the combination of antibiotics from both domains, and may include acetylation, phosphorylation or nucleotidylation activity. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with gentamicin A UPDATED category_aro_cvterm_id with 40942 UPDATED category_aro_accession with 3004015 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin A is part of a complex of broad spectrum aminoglycoside antibiotics. Gentamicin inhibits protein synthesis, resulting in bacterial cell death. " 3439 UPDATE OXA-272 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3504 UPDATE OXA-431 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4909 UPDATE OXA-583 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3430 UPDATE OXA-263 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5723 UPDATE YEM-1 carbapenem; antibiotic inactivation; imipenem; YEM beta-lactamase; ARO_category "UPDATED category_aro_name with imipenem UPDATED category_aro_cvterm_id with 36309 UPDATED category_aro_accession with 3000170 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Imipenem is a broad-spectrum antibiotic and is usually taken with cilastatin, which prevents hydrolysis of imipenem by renal dehydropeptidase-I. It is resistant to hydrolysis by most other beta-lactamases. Notable exceptions are the KPC beta-lactamases and Ambler Class B enzymes. " 3432 UPDATE OXA-265 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3433 UPDATE OXA-266 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3434 UPDATE OXA-267 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3435 UPDATE OXA-268 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3436 UPDATE OXA-269 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3437 UPDATE OXA-270 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 674 UPDATE OXA-15 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1242 UPDATE aadA6/aadA10 antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-nucleotidyltransferase enzymes with modification regiospecificity based at the 3''-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics by transfer of an AMP group from an ATP substrate to the 3''-hydroxyl group of the compound. " 4848 UPDATE OXA-513 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4849 UPDATE OXA-514 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2031 UPDATE OXA-173 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2030 UPDATE AAC(3)-IXa antibiotic inactivation; AAC(3); aminoglycoside antibiotic; neomycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 3-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 3-amino group of the compound. " 4844 UPDATE OXA-509 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4845 UPDATE OXA-510 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4846 UPDATE OXA-511 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4847 UPDATE OXA-512 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4840 UPDATE OXA-505 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4841 UPDATE OXA-506 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4842 UPDATE OXA-507 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4843 UPDATE OXA-508 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 959 UPDATE OXA-64 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 892 UPDATE APH(6)-Ic antibiotic inactivation; APH(6); streptomycin; aminoglycoside antibiotic; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-phosphotransferase enzymes with modification regiospecificity based at the 6-hydroxyl group of the respective antibiotic. These enzymes are characterized by enzymatic antibiotic inactivation, specifically of streptomycin, by the ATP-dependent phosphorylation of the 6-hydroxyl group of the compound. " 677 UPDATE OXA-171 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4908 UPDATE OXA-582 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 897 UPDATE OXA-383 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 898 UPDATE VEB-9 antibiotic inactivation; monobactam; cephalosporin; VEB beta-lactamase; ARO_category "DELETED 36727 " 899 UPDATE OXA-94 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1246 UPDATE AAC(2')-Ic antibiotic inactivation; aminoglycoside antibiotic; gentamicin; AAC(2'); 6'-N-ethylnetilmicin; netilmicin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 2'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 2-amino group of the compound. DELETED 35932 UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. UPDATED category_aro_name with 6'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46127 UPDATED category_aro_accession with 3007377 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 6'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. " 4968 UPDATE OXA-643 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5201 UPDATE OXA-909 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5200 UPDATE OXA-908 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5203 UPDATE OXA-911 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5202 UPDATE OXA-910 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5205 UPDATE OXA-913 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5204 UPDATE OXA-912 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5207 UPDATE OXA-916 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5206 UPDATE OXA-914 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5209 UPDATE OXA-918 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5208 UPDATE OXA-917 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3525 UPDATE OXA-458 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5193 UPDATE OXA-900 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4992 UPDATE OXA-679 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3544 UPDATE OXA-483 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3506 UPDATE OXA-433 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3546 UPDATE OXA-485 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3547 UPDATE OXA-486 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3540 UPDATE OXA-478 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3541 UPDATE OXA-479 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3542 UPDATE OXA-480 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3543 UPDATE OXA-482 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1977 UPDATE AAC(6')-Ik 2'-N-ethylnetilmicin; 5-episisomicin; AAC(6'); aminoglycoside antibiotic; sisomicin; antibiotic inactivation; netilmicin; amikacin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. DELETED 35966 UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. " 1602 UPDATE AAC(6')-Iai 2'-N-ethylnetilmicin; 5-episisomicin; AAC(6'); aminoglycoside antibiotic; sisomicin; antibiotic inactivation; netilmicin; amikacin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. DELETED 35966 UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. " 3548 UPDATE OXA-488 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "DELETED 36727 UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1972 UPDATE OXA-149 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 355 UPDATE TEM-1 penam; antibiotic inactivation; amoxicillin; penem; cefazolin; cephalosporin; cefalotin; monobactam; ampicillin; TEM beta-lactamase; ARO_category "DELETED 35996 " 4954 UPDATE OXA-628 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1909 UPDATE AAC(6')-Iak 2'-N-ethylnetilmicin; 5-episisomicin; AAC(6'); aminoglycoside antibiotic; sisomicin; antibiotic inactivation; netilmicin; amikacin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. UPDATED category_aro_name with amikacin UPDATED category_aro_cvterm_id with 35932 UPDATED category_aro_accession with 0000013 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Amikacin is an aminoglycoside antibiotic that works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with tobramycin UPDATED category_aro_cvterm_id with 35969 UPDATED category_aro_accession with 0000052 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Tobramycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Tobramycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. " 2754 UPDATE ANT(3'')-IIb antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-nucleotidyltransferase enzymes with modification regiospecificity based at the 3''-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics by transfer of an AMP group from an ATP substrate to the 3''-hydroxyl group of the compound. " 805 UPDATE MexC penam; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; ofloxacin; aminocoumarin antibiotic; trimethoprim; gentamicin; novobiocin; macrolide antibiotic; phenicol antibiotic; efflux pump complex or subunit conferring antibiotic resistance; cephalosporin; diaminopyrimidine antibiotic; tetracycline antibiotic; gentamicin C; chloramphenicol; aminoglycoside antibiotic; fluoroquinolone antibiotic; tetracycline; erythromycin; ARO_category "UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 4939 UPDATE OXA-613 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5196 UPDATE OXA-903 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2960 UPDATE OXA-663 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2909 UPDATE OXA-664 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1780 UPDATE OXA-146 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1781 UPDATE AAC(2')-Ia antibiotic inactivation; aminoglycoside antibiotic; gentamicin; AAC(2'); 6'-N-ethylnetilmicin; netilmicin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 2'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 2-amino group of the compound. DELETED 35932 UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. UPDATED category_aro_name with 6'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46127 UPDATED category_aro_accession with 3007377 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 6'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. " 1784 UPDATE OXA-334 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 767 UPDATE OXA-207 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1786 UPDATE mexY erythromycin; arbekacin; tetracycline antibiotic; meropenem; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; ofloxacin; norfloxacin; macrolide antibiotic; carbapenem; cephalosporin; ciprofloxacin; gentamicin C; amikacin; aminoglycoside antibiotic; disinfecting agents and antiseptics; penam; gentamicin; efflux pump complex or subunit conferring antibiotic resistance; cephamycin; acriflavine; fluoroquinolone antibiotic; chloramphenicol; phenicol antibiotic; tetracycline; tobramycin; ARO_category "UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 954 UPDATE APH(3')-IIb antibiotic inactivation; aminoglycoside antibiotic; gentamicin; paromomycin; kanamycin A; APH(3'); gentamicin B; ribostamycin; neomycin; butirosin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-phosphotransferase enzymes with modification regiospecificity based at the 3'-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics, specifically kanamycin and neomycin, by the ATP-dependent phosphorylation of the 3'-hydroxyl group of the compound. DELETED 36997 UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 3321 UPDATE AAC(3)-IIe 2'-N-ethylnetilmicin; antibiotic inactivation; AAC(3); aminoglycoside antibiotic; gentamicin; 6'-N-ethylnetilmicin; sisomicin; netilmicin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 3-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 3-amino group of the compound. DELETED 40942 UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). UPDATED category_aro_name with 6'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46127 UPDATED category_aro_accession with 3007377 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 6'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with tobramycin UPDATED category_aro_cvterm_id with 35969 UPDATED category_aro_accession with 0000052 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Tobramycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Tobramycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. " 3322 UPDATE AAC(3)-IId 2'-N-ethylnetilmicin; antibiotic inactivation; AAC(3); aminoglycoside antibiotic; gentamicin; 6'-N-ethylnetilmicin; sisomicin; netilmicin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 3-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 3-amino group of the compound. DELETED 40942 UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). UPDATED category_aro_name with 6'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46127 UPDATED category_aro_accession with 3007377 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 6'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with tobramycin UPDATED category_aro_cvterm_id with 35969 UPDATED category_aro_accession with 0000052 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Tobramycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Tobramycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. " 4837 UPDATE OXA-502 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3327 UPDATE AAC(2')-IIa antibiotic inactivation; aminoglycoside antibiotic; AAC(2'); kasugamycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 2'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 2-amino group of the compound. " 3328 UPDATE AAC(6')-Im 2'-N-ethylnetilmicin; 5-episisomicin; AAC(6'); aminoglycoside antibiotic; sisomicin; antibiotic inactivation; netilmicin; amikacin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. DELETED 35966 UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. " 5479 UPDATE PDC-35 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; ARO_category "DELETED 36727 " 213 UPDATE OXA-21 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1568 UPDATE OXA-183 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1777 UPDATE OXA-177 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 980 UPDATE y56 beta-lactamase penam; antibiotic inactivation; BlaA beta-lactamase; penem; cephalosporin; ticarcillin; ARO_category "UPDATED category_aro_name with penem UPDATED category_aro_cvterm_id with 40360 UPDATED category_aro_accession with 3003706 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Penems are a class of unsaturated beta-lactam antibiotics with a broad spectrum of antibacterial activity and have a structure which renders them highly resistant to beta-lactamases. All penems are all synthetically made and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. They are structurally similar to carbapenems, however, where carbapenems have a carbon, penems have a sulfur. UPDATED category_aro_name with ticarcillin UPDATED category_aro_cvterm_id with 40523 UPDATED category_aro_accession with 3003832 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Ticarcillin is a carboxypenicillin used for the treatment of Gram-negative bacteria, particularly P. aeruginosa. Ticarcillin's antibiotic properties arise from its ability to prevent cross-linking of peptidoglycan during cell wall synthesis, when the bacteria try to divide, causing cell death. " 1772 UPDATE aadA11 antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-nucleotidyltransferase enzymes with modification regiospecificity based at the 3''-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics by transfer of an AMP group from an ATP substrate to the 3''-hydroxyl group of the compound. " 1979 UPDATE FosA4 fosfomycin; fosfomycin thiol transferase; antibiotic inactivation; phosphonic acid antibiotic; ARO_category "UPDATED category_aro_name with fosfomycin UPDATED category_aro_cvterm_id with 35944 UPDATED category_aro_accession with 0000025 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Fosfomycin (also known as phosphomycin and phosphonomycin) is a broad-spectrum antibiotic produced by certain Streptomyces species. It is effective on gram positive and negative bacteria as it targets the cell wall, an essential feature shared by both bacteria. Its specific target is MurA (MurZ in E.coli), which attaches phosphoenolpyruvate (PEP) to UDP-N-acetylglucosamine, a step of commitment to cell wall synthesis. In the active site of MurA, the active cysteine molecule is alkylated which stops the catalytic reaction. " 2328 UPDATE MUS-2 penam; antibiotic inactivation; penem; carbapenem; MUS beta-lactamase; ticarcillin; amoxicillin; piperacillin; ARO_category "UPDATED category_aro_name with penam UPDATED category_aro_cvterm_id with 36017 UPDATED category_aro_accession with 3000008 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_name with amoxicillin UPDATED category_aro_cvterm_id with 35981 UPDATED category_aro_accession with 0000064 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Amoxicillin is a moderate-spectrum, bacteriolytic, beta-lactam antibiotic used to treat bacterial infections caused by susceptible microorganisms. A derivative of penicillin, it has a wider range of treatment but remains relatively ineffective against Gram-negative bacteria. It is commonly taken with clavulanic acid, a beta-lactamase inhibitor. Like other beta-lactams, amoxicillin interferes with the synthesis of peptidoglycan. UPDATED category_aro_name with piperacillin UPDATED category_aro_cvterm_id with 35995 UPDATED category_aro_accession with 0000078 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Piperacillin is an acetylureidopenicillin and has an extended spectrum of targets relative to other beta-lactam antibiotics. It inhibits cell wall synthesis in bacteria, and is usually taken with the beta-lactamase inhibitor tazobactam to overcome penicillin-resistant bacteria. UPDATED category_aro_name with penem UPDATED category_aro_cvterm_id with 40360 UPDATED category_aro_accession with 3003706 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Penems are a class of unsaturated beta-lactam antibiotics with a broad spectrum of antibacterial activity and have a structure which renders them highly resistant to beta-lactamases. All penems are all synthetically made and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. They are structurally similar to carbapenems, however, where carbapenems have a carbon, penems have a sulfur. UPDATED category_aro_name with ticarcillin UPDATED category_aro_cvterm_id with 40523 UPDATED category_aro_accession with 3003832 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Ticarcillin is a carboxypenicillin used for the treatment of Gram-negative bacteria, particularly P. aeruginosa. Ticarcillin's antibiotic properties arise from its ability to prevent cross-linking of peptidoglycan during cell wall synthesis, when the bacteria try to divide, causing cell death. " 1072 UPDATE OXA-37 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4982 UPDATE OXA-662 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2009 UPDATE aadA6 antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-nucleotidyltransferase enzymes with modification regiospecificity based at the 3''-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics by transfer of an AMP group from an ATP substrate to the 3''-hydroxyl group of the compound. " 289 UPDATE OXA-85 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1299 UPDATE AAC(6')-Ic 2'-N-ethylnetilmicin; 5-episisomicin; AAC(6'); aminoglycoside antibiotic; sisomicin; antibiotic inactivation; netilmicin; amikacin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. UPDATED category_aro_name with amikacin UPDATED category_aro_cvterm_id with 35932 UPDATED category_aro_accession with 0000013 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Amikacin is an aminoglycoside antibiotic that works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with tobramycin UPDATED category_aro_cvterm_id with 35969 UPDATED category_aro_accession with 0000052 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Tobramycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Tobramycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. " 1678 UPDATE AAC(6')-Ib-cr1 antibiotic inactivation; AAC(6')-Ib-cr; AAC(6'); kanamycin A; ciprofloxacin; fluoroquinolone antibiotic; amikacin; aminoglycoside antibiotic; tobramycin; ARO_category "DELETED 40307 UPDATED category_aro_name with AAC(6') UPDATED category_aro_cvterm_id with 36484 UPDATED category_aro_accession with 3000345 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. UPDATED category_aro_name with kanamycin A UPDATED category_aro_cvterm_id with 35966 UPDATED category_aro_accession with 0000049 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Kanamycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Kanamycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with amikacin UPDATED category_aro_cvterm_id with 35932 UPDATED category_aro_accession with 0000013 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Amikacin is an aminoglycoside antibiotic that works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. " 1679 UPDATE OXA-49 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1674 UPDATE AAC(6')-It 2'-N-ethylnetilmicin; 5-episisomicin; AAC(6'); aminoglycoside antibiotic; sisomicin; antibiotic inactivation; netilmicin; amikacin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. DELETED 35966 UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. " 1670 UPDATE nalC sulfonamide antibiotic; penem; panipenem; tetracycline antibiotic; meropenem; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; aztreonam; trimethoprim; aminocoumarin antibiotic; cephalosporin; macrolide antibiotic; carbapenem; ceftazidime; ciprofloxacin; cephamycin; ceftriaxone; colistin B; protein(s) and two-component regulatory system modulating antibiotic efflux; colistin A; peptide antibiotic; diaminopyrimidine antibiotic; ampicillin; penam; sulfamethoxazole; novobiocin; efflux pump complex or subunit conferring antibiotic resistance; trimethoprim-sulfamethoxazole; tetracycline; monobactam; fluoroquinolone antibiotic; erythromycin; phenicol antibiotic; azithromycin; chloramphenicol; ARO_category "DELETED 35996 " 3489 UPDATE OXA-404 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3488 UPDATE OXA-403 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 981 UPDATE OXA-86 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3765 UPDATE FosL1 fosfomycin; fosfomycin thiol transferase; antibiotic inactivation; phosphonic acid antibiotic; ARO_category "UPDATED category_aro_name with fosfomycin UPDATED category_aro_cvterm_id with 35944 UPDATED category_aro_accession with 0000025 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Fosfomycin (also known as phosphomycin and phosphonomycin) is a broad-spectrum antibiotic produced by certain Streptomyces species. It is effective on gram positive and negative bacteria as it targets the cell wall, an essential feature shared by both bacteria. Its specific target is MurA (MurZ in E.coli), which attaches phosphoenolpyruvate (PEP) to UDP-N-acetylglucosamine, a step of commitment to cell wall synthesis. In the active site of MurA, the active cysteine molecule is alkylated which stops the catalytic reaction. " 4913 UPDATE OXA-587 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1978 UPDATE OXA-200 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3481 UPDATE OXA-364 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3480 UPDATE OXA-346 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3483 UPDATE OXA-373 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3482 UPDATE OXA-372 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1151 UPDATE OXA-240 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1099 UPDATE OXA-48 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; temocillin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3487 UPDATE OXA-401 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3486 UPDATE OXA-400 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 267 UPDATE OXA-43 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4938 UPDATE OXA-612 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 264 UPDATE lsaE pleuromutilin; pleuromutilin antibiotic; lsa-type ABC-F protein; lincomycin; antibiotic target protection; streptogramin antibiotic; lincosamide antibiotic; model_sequences; model_param "UPDATED partial with 0 UPDATED sequence with ATGTCCTTAATAAATGTTTCAAATCTAACTTTTTCATATGAAGGAAGTTATGACAATATTTTTGAAAATGTAAGTTTTCAGATAGATACAGATTGGAAACTCGGTTTTATTGGAAGAAACGGACGCGGTAAAACTACTTTCTTAAATTTACTGCTTGGCAAATATGCGTATTCCGGCAATATAAGTTCTACAGTTAAGTTTGAGTATTTTCCTTATGATGTGGAAGATAAGAGTCTATATACAATTGAAGTAATGAAGAGTATTTGTACGGAATGTATGGATTGGGAGATTTTTCGTGAAATATCATTGCTTGATGTTCAAGAAGATGCTTTATATCGTCCGTTTAATACATTGTCAAATGGTGAGCAAACGAAGGTCCTTCTTGCAGCTTTATTCCTTACAGCGAGTTGTTTCCTGCTTATTGATGAACCTACAAACCATCTTGACATCGATGCACGTAATGTAGTGCAAAACTATTTGAAACGCAAGAAGGGGTTTATTTTGGTATCTCATGATAGAAGCTTACTTGATCAATGTGTTGACCATATACTATCTATCAATAAAACGAATATCGAAATCCAAAAGGGAAATTTTACTTCTTGGTGGGAGAACAAAACGTTACAAGATAATTTTGAACTGGCAGAAAACAAGAAACTCCTTAAAGAAATAGGAAGGTTGTCTTATGCAGCAAAACGTAGTTCAAACTGGTCAAATAAAGTAGAAAAAAGTAAATATGGAACAACAAATTCTGGTTCAAAACTGGATAAGGGTTATGTTGGACATAAGGCTGCAAAAGCGATGAAACGTGCCAAAAATATTGAGTCAAGACATCAGGAAGCCGTTTTACAAAAATCAGAACTGCTCCACAACATTGAACAATATGATGACTTAAAAATTTCACCACTTGAATTTCACAAAGAGTGCTTAATAGAAGCGAATGATTTATCATTGTCTTATGGAGATAAAGAAGTATGCAGTAATCTTAATTTCAGAGTCAATATTGGTGATAGAGTTGCCATTATCGGAAAAAATGGGAGTGGTAAGTCTAGTATCCTAAAATTGATTAATGGAGATGATATTAAATTTACCGGAAATTTTATGCTAGCAAGTGGACTAAAAATTTCTTATATTTCGCAAGATACTTCATATTTAAAAGGTAATCTATCTGAATTTGCCTATAATAATAAGATCGATGAAACTCTATTTAAAACGATTCTTCGTAAACTGGATTTTAATAGAGAGCAGTTTGATAAGAACATGGTGGATTTTAGTGCTGGTCAGAAAAAGAAAGTACTAATTGCTAAAAGCCTTTGTGAAAGTGCACATTTGTATATATGGGATGAGCCATTGAACTATATTGATATTTTTTCACGTATCCAAATTGAAAAAATGATTTTGGAATATTGTCCTACACTATTGTTTGTGGAGCATGATGATGCTTTTTGCAATAACATTTGTACGAAAAATATTAATTTAGGTTTGTAG UPDATED fmax with 9393 UPDATED accession with AF408195.1 UPDATED fmin with 7908 UPDATED strand with + UPDATED NCBI_taxonomy_name with Enterococcus faecalis UPDATED NCBI_taxonomy_id with 1351 UPDATED NCBI_taxonomy_cvterm_id with 35918 UPDATED accession with AAL05553.1 UPDATED sequence with MSLINVSNLTFSYEGSYDNIFENVSFQIDTDWKLGFIGRNGRGKTTFLNLLLGKYAYSGNISSTVKFEYFPYDVEDKSLYTIEVMKSICTECMDWEIFREISLLDVQEDALYRPFNTLSNGEQTKVLLAALFLTASCFLLIDEPTNHLDIDARNVVQNYLKRKKGFILVSHDRSLLDQCVDHILSINKTNIEIQKGNFTSWWENKTLQDNFELAENKKLLKEIGRLSYAAKRSSNWSNKVEKSKYGTTNSGSKLDKGYVGHKAAKAMKRAKNIESRHQEAVLQKSELLHNIEQYDDLKISPLEFHKECLIEANDLSLSYGDKEVCSNLNFRVNIGDRVAIIGKNGSGKSSILKLINGDDIKFTGNFMLASGLKISYISQDTSYLKGNLSEFAYNNKIDETLFKTILRKLDFNREQFDKNMVDFSAGQKKKVLIAKSLCESAHLYIWDEPLNYIDIFSRIQIEKMILEYCPTLLFVEHDDAFCNNICTKNINLGL UPDATED param_value with 800 " 478 UPDATE AAC(3)-IIa 2'-N-ethylnetilmicin; antibiotic inactivation; AAC(3); aminoglycoside antibiotic; gentamicin; 6'-N-ethylnetilmicin; sisomicin; netilmicin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 3-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 3-amino group of the compound. DELETED 35933 UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). UPDATED category_aro_name with 6'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46127 UPDATED category_aro_accession with 3007377 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 6'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. " 1551 UPDATE OXA-78 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2551 UPDATE glycopeptide resistance gene cluster VanI glycopeptide antibiotic; glycopeptide resistance gene cluster; antibiotic target alteration; vancomycin; teicoplanin; model_description "UPDATED model_description with Gene Cluster Meta-Models (GCM) are used to curate spatial clusters of individual genes within operons, such as for glycopeptide resistance gene clusters. The individual genes will have their own individual detection models (e.g. PHM, PVM, POM, etc.) while the GCM checks to see if all the component genes of the cluster have a Strict or Perfect hit and are ordered correctly within an operon. GCMs are encoded using the gene order parameter. This model type is still under development and not currently supported by the Resistance Gene Identifier (RGI) software. " 1552 UPDATE MUS-1 penam; antibiotic inactivation; penem; carbapenem; MUS beta-lactamase; ticarcillin; amoxicillin; piperacillin; ARO_category "UPDATED category_aro_name with penam UPDATED category_aro_cvterm_id with 36017 UPDATED category_aro_accession with 3000008 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_name with amoxicillin UPDATED category_aro_cvterm_id with 35981 UPDATED category_aro_accession with 0000064 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Amoxicillin is a moderate-spectrum, bacteriolytic, beta-lactam antibiotic used to treat bacterial infections caused by susceptible microorganisms. A derivative of penicillin, it has a wider range of treatment but remains relatively ineffective against Gram-negative bacteria. It is commonly taken with clavulanic acid, a beta-lactamase inhibitor. Like other beta-lactams, amoxicillin interferes with the synthesis of peptidoglycan. UPDATED category_aro_name with piperacillin UPDATED category_aro_cvterm_id with 35995 UPDATED category_aro_accession with 0000078 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Piperacillin is an acetylureidopenicillin and has an extended spectrum of targets relative to other beta-lactam antibiotics. It inhibits cell wall synthesis in bacteria, and is usually taken with the beta-lactamase inhibitor tazobactam to overcome penicillin-resistant bacteria. UPDATED category_aro_name with penem UPDATED category_aro_cvterm_id with 40360 UPDATED category_aro_accession with 3003706 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Penems are a class of unsaturated beta-lactam antibiotics with a broad spectrum of antibacterial activity and have a structure which renders them highly resistant to beta-lactamases. All penems are all synthetically made and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. They are structurally similar to carbapenems, however, where carbapenems have a carbon, penems have a sulfur. UPDATED category_aro_name with ticarcillin UPDATED category_aro_cvterm_id with 40523 UPDATED category_aro_accession with 3003832 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Ticarcillin is a carboxypenicillin used for the treatment of Gram-negative bacteria, particularly P. aeruginosa. Ticarcillin's antibiotic properties arise from its ability to prevent cross-linking of peptidoglycan during cell wall synthesis, when the bacteria try to divide, causing cell death. " 59 UPDATE OXA-256 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 61 UPDATE OXA-330 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3283 UPDATE Klebsiella pneumoniae KpnE peptide antibiotic; triclosan; rifampin; small multidrug resistance (SMR) antibiotic efflux pump; antibiotic efflux; aminoglycoside antibiotic; rifamycin antibiotic; colistin A; macrolide antibiotic; colistin B; efflux pump complex or subunit conferring antibiotic resistance; cephalosporin; cefepime; benzalkonium chloride; tetracycline antibiotic; chlorhexidine; streptomycin; ceftriaxone; disinfecting agents and antiseptics; tetracycline; erythromycin; ARO_category "DELETED 36003 UPDATED category_aro_name with small multidrug resistance (SMR) antibiotic efflux pump UPDATED category_aro_cvterm_id with 36004 UPDATED category_aro_accession with 0010003 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with Directed pumping of antibiotic out of a cell to confer resistance. Small multidrug resistance (SMR) proteins are a relatively small family of transporters, restricted to prokaryotic cells. They are also the smallest multidrug transporters, with only four transmembrane alpha-helices and no significant extramembrane domain. " 5004 UPDATE OXA-692 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 51 UPDATE AAC(3)-IIIc antibiotic inactivation; aminoglycoside antibiotic; AAC(3); gentamicin; gentamicin A; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 3-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 3-amino group of the compound. UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 2396 UPDATE OXA-368 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1559 UPDATE mtrA penam; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; protein(s) and two-component regulatory system modulating antibiotic efflux; macrolide antibiotic; efflux pump complex or subunit conferring antibiotic resistance; penicillin; azithromycin; erythromycin; model_sequences; model_param "UPDATED partial with 0 UPDATED sequence with ATGGACATTCTGGACAAACTGGTCGATCTCGCCCAATTGACGGGCAGTGCGGATGTGCAGTGCCTTTTGGGCGGACAATGGTCGGTACGGCATGAAACCTTGCAATGCGAAGGGCTGGTACACATTGTTACGGCGGGCAGCGGTTATCTCTGCATCGACGGCGAAACTTCCCCGCGTCCGGTCGGCACGGGCGATATTGTATTTTTCCCGCGCGGCTTGGGTCATGTGTTGAGCCACGACGGAAAATACGGAGAAAGTTTACAACCGGACATACGACAAAACGGCACATTTATGGTCAAACAGTGCGGCAACGGGCTGGATATGAGCCTGTTTTGCGCCCGTTTCCGCTACGACACCCACGCCGATTTGATGAACGGGCTGCCGGAAACCGTTTTTCTGAACATTGCCCATCCAAGTTTGCAGTATGTGGTTTCAATGCTGCAACTGGAAAGCGAAAAACCTTTGACGGGGACGGTTTCCGTGGTCAACGCATTACCGTCCGTCCTGCTGGTGCTTATCCTGCGCGCCTATCTCGAACAGGATAAGGATGTCGAACTCTCGGGCGTATTGAAAGGTTGGCAGGACAAACGTTTGGGACATTTGATCCAAAAGGTGATAGACAAACCGGAAGACGAATGGAATATTGACAAAATGGTTGCCGCCGCCAATATGTCGCGCGCGCAACTGATGCGCCGCTTCAAAAGCCAAGTCGGACTCAGCCCGCACGCCTTTGTGAACCATATCCGCCTGCAAAAAGGCGCATTGCTGCTGAAGAAAACCCCGGATTCGGTTTTGGAGGTCGCGCTGTCGGTGGGCTTTCAGTCGGAAACGCATTTCGGCAAGGCGTTCAAACGGCAATATCACGTTTCGCCGGGGCAATACCGGAAAGAAGGCGGGCAAAAATAA UPDATED fmax with 906 UPDATED accession with AF128627.1 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Neisseria gonorrhoeae UPDATED NCBI_taxonomy_id with 485 UPDATED NCBI_taxonomy_cvterm_id with 36806 UPDATED accession with AAD44693.1 UPDATED sequence with MDILDKLVDLAQLTGSADVQCLLGGQWSVRHETLQCEGLVHIVTAGSGYLCIDGETSPRPVGTGDIVFFPRGLGHVLSHDGKYGESLQPDIRQNGTFMVKQCGNGLDMSLFCARFRYDTHADLMNGLPETVFLNIAHPSLQYVVSMLQLESEKPLTGTVSVVNALPSVLLVLILRAYLEQDKDVELSGVLKGWQDKRLGHLIQKVIDKPEDEWNIDKMVAAANMSRAQLMRRFKSQVGLSPHAFVNHIRLQKGALLLKKTPDSVLEVALSVGFQSETHFGKAFKRQYHVSPGQYRKEGGQK UPDATED param_value with 400 " 2395 UPDATE apmA antibiotic inactivation; aminoglycoside antibiotic; apramycin; apm acetyltransferase; ARO_category "UPDATED category_aro_name with apm acetyltransferase " 1294 UPDATE Sed-1 penam; antibiotic inactivation; Sed beta-lactamase; penem; cephalosporin; cefalotin; ticarcillin; cefuroxime; amoxicillin; piperacillin; ARO_category "UPDATED category_aro_name with penem UPDATED category_aro_cvterm_id with 40360 UPDATED category_aro_accession with 3003706 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Penems are a class of unsaturated beta-lactam antibiotics with a broad spectrum of antibacterial activity and have a structure which renders them highly resistant to beta-lactamases. All penems are all synthetically made and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. They are structurally similar to carbapenems, however, where carbapenems have a carbon, penems have a sulfur. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with ticarcillin UPDATED category_aro_cvterm_id with 40523 UPDATED category_aro_accession with 3003832 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Ticarcillin is a carboxypenicillin used for the treatment of Gram-negative bacteria, particularly P. aeruginosa. Ticarcillin's antibiotic properties arise from its ability to prevent cross-linking of peptidoglycan during cell wall synthesis, when the bacteria try to divide, causing cell death. UPDATED category_aro_name with cefuroxime UPDATED category_aro_cvterm_id with 35980 UPDATED category_aro_accession with 0000063 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefuroxime is a second-generation cephalosporin antibiotic with increased stability with beta-lactamases than first-generation cephalosporins. Cefuroxime is active against Gram-positive organisms but less active against methicillin-resistant strains. UPDATED category_aro_name with amoxicillin UPDATED category_aro_cvterm_id with 35981 UPDATED category_aro_accession with 0000064 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Amoxicillin is a moderate-spectrum, bacteriolytic, beta-lactam antibiotic used to treat bacterial infections caused by susceptible microorganisms. A derivative of penicillin, it has a wider range of treatment but remains relatively ineffective against Gram-negative bacteria. It is commonly taken with clavulanic acid, a beta-lactamase inhibitor. Like other beta-lactams, amoxicillin interferes with the synthesis of peptidoglycan. UPDATED category_aro_name with piperacillin UPDATED category_aro_cvterm_id with 35995 UPDATED category_aro_accession with 0000078 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Piperacillin is an acetylureidopenicillin and has an extended spectrum of targets relative to other beta-lactam antibiotics. It inhibits cell wall synthesis in bacteria, and is usually taken with the beta-lactamase inhibitor tazobactam to overcome penicillin-resistant bacteria. " 5147 UPDATE OXA-849 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1410 UPDATE OXA-19 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1411 UPDATE OXA-62 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2254 UPDATE Staphylococcus aureus fusA with mutation conferring resistance to fusidic acid antibiotic target alteration; fusidic acid; antibiotic resistant fusA; fusidane antibiotic; ARO_category "UPDATED category_aro_name with fusidic acid UPDATED category_aro_cvterm_id with 37139 UPDATED category_aro_accession with 3000759 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Fusidic acid is the only commercially available fusidane, a group of steroid-like antibiotics. It is most active against Gram-positive bacteria, and acts by inhibiting elongation factor G to block protein synthesis. " 1415 UPDATE AAC(2')-Id antibiotic inactivation; aminoglycoside antibiotic; gentamicin; AAC(2'); 6'-N-ethylnetilmicin; netilmicin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 2'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 2-amino group of the compound. DELETED 35932 UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. UPDATED category_aro_name with 6'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46127 UPDATED category_aro_accession with 3007377 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 6'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. " 1416 UPDATE OXA-89 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3299 UPDATE Klebsiella pneumoniae KpnH penem; piperacillin; antibiotic efflux; imipenem; major facilitator superfamily (MFS) antibiotic efflux pump; norfloxacin; cephalosporin; macrolide antibiotic; carbapenem; ceftazidime; spectinomycin; ciprofloxacin; gentamicin C; streptomycin; aminoglycoside antibiotic; polymyxin B1; polymyxin B; peptide antibiotic; ticarcillin; ertapenem; penam; gentamicin; efflux pump complex or subunit conferring antibiotic resistance; polymyxin B2; polymyxin B3; polymyxin B4; fluoroquinolone antibiotic; erythromycin; azithromycin; tobramycin; ARO_category "UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 5010 UPDATE OXA-698 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3431 UPDATE OXA-264 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4899 UPDATE OXA-572 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4898 UPDATE OXA-569 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5014 UPDATE OXA-702 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5015 UPDATE OXA-703 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5016 UPDATE OXA-704 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1325 UPDATE OXA-65 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5151 UPDATE OXA-854 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5150 UPDATE OXA-853 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5153 UPDATE OXA-856 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4890 UPDATE OXA-561 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5155 UPDATE OXA-858 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4896 UPDATE OXA-567 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5157 UPDATE OXA-860 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4894 UPDATE OXA-565 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5137 UPDATE OXA-836 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2751 UPDATE APH(3')-IX kanamycin A; APH(3'); amikacin; aminoglycoside antibiotic; antibiotic inactivation; ARO_description; CARD_short_name; ARO_category; model_name; ARO_name "UPDATED ARO_description with APH(3')-IXa is an aminoglycoside phosphoryltransferase that acts on the 3-OH target of aminoglycosides. UPDATED CARD_short_name with APH(3')-IXa UPDATED category_aro_description with A category of aminoglycoside O-phosphotransferase enzymes with modification regiospecificity based at the 3'-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics, specifically kanamycin and neomycin, by the ATP-dependent phosphorylation of the 3'-hydroxyl group of the compound. DELETED 36997 UPDATED category_aro_name with amikacin UPDATED category_aro_cvterm_id with 35932 UPDATED category_aro_accession with 0000013 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Amikacin is an aminoglycoside antibiotic that works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED model_name with APH(3')-IXa UPDATED ARO_name with APH(3')-IXa " 110 UPDATE AAC(6')-Iu 2'-N-ethylnetilmicin; 5-episisomicin; AAC(6'); aminoglycoside antibiotic; sisomicin; antibiotic inactivation; netilmicin; amikacin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. DELETED 35966 UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. " 5769 UPDATE PRC-1 penam; cefotaxime; PRC beta-lactamase; cephalosporin; cefazolin; benzylpenicillin; antibiotic inactivation; ampicillin; amoxicillin; ceftriaxone; ARO_category "DELETED 35996 " 205 UPDATE APH(4)-Ia antibiotic inactivation; hygromycin B; aminoglycoside antibiotic; APH(4); ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-phosphotransferase enzymes with modification regiospecificity based at the 4-hydroxyl group of the respective antibiotic. These enzymes are characterized by enzymatic antibiotic inactivation, specifically of hygromycin, by the ATP-dependent phosphorylation of the 4-hydroxyl group of the compound. DELETED 40307 " 5063 UPDATE OXA-754 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 312 UPDATE OXA-167 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5761 UPDATE VAM-1 penam; cefotaxime; VAM beta-lactamase; carbapenem; tetracycline antibiotic; cephalosporin; antibiotic inactivation; ampicillin; ceftriaxone; tetracycline; ARO_category "DELETED 35981 " 1858 UPDATE OXA-387 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 537 UPDATE OXA-120 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4802 UPDATE OXA-114b penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4803 UPDATE OXA-114c penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4804 UPDATE OXA-114d penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4805 UPDATE OXA-114e penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4806 UPDATE OXA-114f penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4807 UPDATE OXA-114g penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4808 UPDATE OXA-114h penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4809 UPDATE OXA-114i penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1852 UPDATE rmtF gentamicin; 16S rRNA methyltransferase (G1405); kanamycin A; antibiotic target alteration; astromicin; aminoglycoside antibiotic; gentamicin A; ARO_category "UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 1853 UPDATE OXA-20 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1854 UPDATE rmtA kanamycin A; aminoglycoside antibiotic; isepamicin; gentamicin; 16S rRNA methyltransferase (G1405); sisomicin; arbekacin; gentamicin B; netilmicin; antibiotic target alteration; gentamicin C; amikacin; dibekacin; G418; tobramycin; ARO_category "UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 3843 UPDATE AAC(6')-Ib-cr6 antibiotic inactivation; AAC(6')-Ib-cr; AAC(6'); kanamycin A; ciprofloxacin; fluoroquinolone antibiotic; amikacin; aminoglycoside antibiotic; tobramycin; ARO_category "UPDATED category_aro_name with AAC(6') UPDATED category_aro_cvterm_id with 36484 UPDATED category_aro_accession with 3000345 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. " 4949 UPDATE OXA-623 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 35 UPDATE FosA2 fosfomycin; fosfomycin thiol transferase; antibiotic inactivation; phosphonic acid antibiotic; ARO_category "UPDATED category_aro_name with fosfomycin UPDATED category_aro_cvterm_id with 35944 UPDATED category_aro_accession with 0000025 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Fosfomycin (also known as phosphomycin and phosphonomycin) is a broad-spectrum antibiotic produced by certain Streptomyces species. It is effective on gram positive and negative bacteria as it targets the cell wall, an essential feature shared by both bacteria. Its specific target is MurA (MurZ in E.coli), which attaches phosphoenolpyruvate (PEP) to UDP-N-acetylglucosamine, a step of commitment to cell wall synthesis. In the active site of MurA, the active cysteine molecule is alkylated which stops the catalytic reaction. " 1526 UPDATE AAC(6')-Iaa 2'-N-ethylnetilmicin; 5-episisomicin; AAC(6'); aminoglycoside antibiotic; sisomicin; antibiotic inactivation; netilmicin; amikacin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. DELETED 35966 UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. " 1255 UPDATE OXA-119 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2176 UPDATE glycopeptide resistance gene cluster VanN glycopeptide antibiotic; glycopeptide resistance gene cluster; antibiotic target alteration; vancomycin; model_description "UPDATED model_description with Gene Cluster Meta-Models (GCM) are used to curate spatial clusters of individual genes within operons, such as for glycopeptide resistance gene clusters. The individual genes will have their own individual detection models (e.g. PHM, PVM, POM, etc.) while the GCM checks to see if all the component genes of the cluster have a Strict or Perfect hit and are ordered correctly within an operon. GCMs are encoded using the gene order parameter. This model type is still under development and not currently supported by the Resistance Gene Identifier (RGI) software. " 2177 UPDATE glycopeptide resistance gene cluster VanA glycopeptide antibiotic; glycopeptide resistance gene cluster; antibiotic target alteration; vancomycin; teicoplanin; model_description "UPDATED model_description with Gene Cluster Meta-Models (GCM) are used to curate spatial clusters of individual genes within operons, such as for glycopeptide resistance gene clusters. The individual genes will have their own individual detection models (e.g. PHM, PVM, POM, etc.) while the GCM checks to see if all the component genes of the cluster have a Strict or Perfect hit and are ordered correctly within an operon. GCMs are encoded using the gene order parameter. This model type is still under development and not currently supported by the Resistance Gene Identifier (RGI) software. " 1399 UPDATE OXA-315 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1523 UPDATE MexD penam; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; ofloxacin; aminocoumarin antibiotic; trimethoprim; gentamicin; novobiocin; macrolide antibiotic; phenicol antibiotic; efflux pump complex or subunit conferring antibiotic resistance; cephalosporin; diaminopyrimidine antibiotic; tetracycline antibiotic; gentamicin C; chloramphenicol; aminoglycoside antibiotic; fluoroquinolone antibiotic; tetracycline; erythromycin; ARO_category "UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 4967 UPDATE OXA-642 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1396 UPDATE OXA-11 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2071 UPDATE AAC(6')-Ib8 antibiotic inactivation; AAC(6'); kanamycin A; amikacin; aminoglycoside antibiotic; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. UPDATED category_aro_name with kanamycin A UPDATED category_aro_cvterm_id with 35966 UPDATED category_aro_accession with 0000049 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Kanamycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Kanamycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with amikacin UPDATED category_aro_cvterm_id with 35932 UPDATED category_aro_accession with 0000013 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Amikacin is an aminoglycoside antibiotic that works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with tobramycin UPDATED category_aro_cvterm_id with 35969 UPDATED category_aro_accession with 0000052 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Tobramycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Tobramycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. " 4964 UPDATE OXA-638 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4963 UPDATE OXA-637 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1392 UPDATE aadA22 antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-nucleotidyltransferase enzymes with modification regiospecificity based at the 3''-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics by transfer of an AMP group from an ATP substrate to the 3''-hydroxyl group of the compound. " 4961 UPDATE OXA-635 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 646 UPDATE OXA-349 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5017 UPDATE OXA-705 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1419 UPDATE OXA-454 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1420 UPDATE aadA5 antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-nucleotidyltransferase enzymes with modification regiospecificity based at the 3''-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics by transfer of an AMP group from an ATP substrate to the 3''-hydroxyl group of the compound. " 300 UPDATE AAC(6')-29a antibiotic inactivation; aminoglycoside antibiotic; AAC(6'); dibekacin; kanamycin A; amikacin; isepamicin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. " 5087 UPDATE OXA-778 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3519 UPDATE OXA-450 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5142 UPDATE OXA-843 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3451 UPDATE OXA-287 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5128 UPDATE OXA-826 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5129 UPDATE OXA-827 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5143 UPDATE OXA-844 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3266 UPDATE CAM-1 penam; carbapenem; imipenem; cephalosporin; cefoxitin; cefotaxime; ceftazidime; antibiotic inactivation; cephamycin; CAM beta-lactamase; ceftolozane; doripenem; meropenem; ARO_category "DELETED 40951 " 5124 UPDATE OXA-821 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3456 UPDATE OXA-293 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1939 UPDATE AAC(6')-Ix 2'-N-ethylnetilmicin; 5-episisomicin; AAC(6'); aminoglycoside antibiotic; sisomicin; antibiotic inactivation; netilmicin; amikacin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. DELETED 35966 UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. " 5127 UPDATE OXA-824 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5120 UPDATE OXA-816 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 649 UPDATE OXA-115 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5122 UPDATE OXA-819 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 418 UPDATE OXA-325 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3467 UPDATE OXA-305 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3466 UPDATE OXA-304 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3465 UPDATE OXA-303 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3464 UPDATE OXA-302 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3463 UPDATE OXA-301 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3462 UPDATE OXA-300 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3461 UPDATE OXA-299 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 55 UPDATE OXA-69 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5083 UPDATE OXA-774 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5082 UPDATE OXA-773 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5081 UPDATE OXA-772 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3503 UPDATE OXA-430 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2157 UPDATE Escherichia coli 16S rRNA (rrsB) mutation conferring resistance to gentamicin C antibiotic target alteration; aminoglycoside antibiotic; gentamicin C; gentamicin; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; ARO_category "UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 3505 UPDATE OXA-432 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 849 UPDATE OXA-138 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3468 UPDATE OXA-306 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2679 UPDATE MexAB-OprM with MexR mutations confers resistance to multiple antibiotics sulfonamide antibiotic; penem; panipenem; tetracycline antibiotic; meropenem; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; aztreonam; trimethoprim; aminocoumarin antibiotic; cephalosporin; macrolide antibiotic; carbapenem; ceftazidime; ciprofloxacin; cephamycin; ceftriaxone; colistin B; colistin A; peptide antibiotic; diaminopyrimidine antibiotic; ampicillin; penam; sulfamethoxazole; novobiocin; efflux pump complex or subunit conferring antibiotic resistance; trimethoprim-sulfamethoxazole; tetracycline; monobactam; fluoroquinolone antibiotic; erythromycin; phenicol antibiotic; azithromycin; chloramphenicol; ARO_category "DELETED 35996 " 4966 UPDATE OXA-640 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1417 UPDATE OXA-131 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3820 UPDATE AAC(3)-IIg 2'-N-ethylnetilmicin; antibiotic inactivation; AAC(3); aminoglycoside antibiotic; gentamicin; 6'-N-ethylnetilmicin; sisomicin; netilmicin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 3-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 3-amino group of the compound. DELETED 40942 UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). UPDATED category_aro_name with 6'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46127 UPDATED category_aro_accession with 3007377 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 6'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with tobramycin UPDATED category_aro_cvterm_id with 35969 UPDATED category_aro_accession with 0000052 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Tobramycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Tobramycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. " 3458 UPDATE OXA-295 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3460 UPDATE OXA-298 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5159 UPDATE OXA-862 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3459 UPDATE OXA-297 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5184 UPDATE OXA-887 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5158 UPDATE OXA-861 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5126 UPDATE OXA-823 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4998 UPDATE OXA-686 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5012 UPDATE OXA-700 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4989 UPDATE OXA-676 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1587 UPDATE OXA-10 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "DELETED 36727 UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5013 UPDATE OXA-701 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1326 UPDATE OXA-170 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5220 UPDATE OXA-932 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5094 UPDATE OXA-786 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1986 UPDATE OXA-309 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4063 UPDATE OXA-930 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4060 UPDATE OXA-671 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4061 UPDATE OXA-673 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4067 UPDATE OXA-496 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1980 UPDATE OXA-247 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4065 UPDATE OXA-641 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5230 UPDATE OXA-946 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1730 UPDATE OXA-235 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1733 UPDATE OXA-415 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5233 UPDATE OXA-949 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1737 UPDATE ANT(4')-Ia antibiotic inactivation; tobramycin; dibekacin; ANT(4'); amikacin; isepamicin; aminoglycoside antibiotic; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-nucleotidyltransferase enzymes with modification regiospecificity based at the 4'-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics by transfer of an AMP group from an ATP substrate to the 4-hydroxyl group of the compound. DELETED 40307 UPDATED category_aro_name with amikacin UPDATED category_aro_cvterm_id with 35932 UPDATED category_aro_accession with 0000013 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Amikacin is an aminoglycoside antibiotic that works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. " 5042 UPDATE OXA-732 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5018 UPDATE OXA-706 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 732 UPDATE OXA-237 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5041 UPDATE OXA-731 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2713 UPDATE MexXY-OprM erythromycin; tetracycline antibiotic; meropenem; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; ofloxacin; norfloxacin; macrolide antibiotic; carbapenem; cephalosporin; ciprofloxacin; gentamicin C; amikacin; aminoglycoside antibiotic; disinfecting agents and antiseptics; penam; gentamicin; efflux pump complex or subunit conferring antibiotic resistance; cephamycin; acriflavine; fluoroquinolone antibiotic; chloramphenicol; phenicol antibiotic; tetracycline; tobramycin; ARO_category "UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 4859 UPDATE OXA-524 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4891 UPDATE OXA-562 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 569 UPDATE OXA-228 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1329 UPDATE ANT(4')-IIb antibiotic inactivation; isepamicin; ANT(4'); amikacin; aminoglycoside antibiotic; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-nucleotidyltransferase enzymes with modification regiospecificity based at the 4'-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics by transfer of an AMP group from an ATP substrate to the 4-hydroxyl group of the compound. DELETED 37001 " 4948 UPDATE OXA-622 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4965 UPDATE OXA-639 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 560 UPDATE OXA-77 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4897 UPDATE OXA-568 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 758 UPDATE OXA-198 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 566 UPDATE OXA-32 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5154 UPDATE OXA-857 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2183 UPDATE glycopeptide resistance gene cluster VanB glycopeptide antibiotic; glycopeptide resistance gene cluster; antibiotic target alteration; vancomycin; model_description "UPDATED model_description with Gene Cluster Meta-Models (GCM) are used to curate spatial clusters of individual genes within operons, such as for glycopeptide resistance gene clusters. The individual genes will have their own individual detection models (e.g. PHM, PVM, POM, etc.) while the GCM checks to see if all the component genes of the cluster have a Strict or Perfect hit and are ordered correctly within an operon. GCMs are encoded using the gene order parameter. This model type is still under development and not currently supported by the Resistance Gene Identifier (RGI) software. " 2182 UPDATE glycopeptide resistance gene cluster VanD glycopeptide antibiotic; glycopeptide resistance gene cluster; antibiotic target alteration; vancomycin; teicoplanin; model_description "UPDATED model_description with Gene Cluster Meta-Models (GCM) are used to curate spatial clusters of individual genes within operons, such as for glycopeptide resistance gene clusters. The individual genes will have their own individual detection models (e.g. PHM, PVM, POM, etc.) while the GCM checks to see if all the component genes of the cluster have a Strict or Perfect hit and are ordered correctly within an operon. GCMs are encoded using the gene order parameter. This model type is still under development and not currently supported by the Resistance Gene Identifier (RGI) software. " 163 UPDATE OXA-376 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3428 UPDATE OXA-261 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2186 UPDATE glycopeptide resistance gene cluster VanG glycopeptide antibiotic; glycopeptide resistance gene cluster; antibiotic target alteration; vancomycin; model_description "UPDATED model_description with Gene Cluster Meta-Models (GCM) are used to curate spatial clusters of individual genes within operons, such as for glycopeptide resistance gene clusters. The individual genes will have their own individual detection models (e.g. PHM, PVM, POM, etc.) while the GCM checks to see if all the component genes of the cluster have a Strict or Perfect hit and are ordered correctly within an operon. GCMs are encoded using the gene order parameter. This model type is still under development and not currently supported by the Resistance Gene Identifier (RGI) software. " 2185 UPDATE glycopeptide resistance gene cluster VanM glycopeptide antibiotic; glycopeptide resistance gene cluster; antibiotic target alteration; vancomycin; teicoplanin; model_description "UPDATED model_description with Gene Cluster Meta-Models (GCM) are used to curate spatial clusters of individual genes within operons, such as for glycopeptide resistance gene clusters. The individual genes will have their own individual detection models (e.g. PHM, PVM, POM, etc.) while the GCM checks to see if all the component genes of the cluster have a Strict or Perfect hit and are ordered correctly within an operon. GCMs are encoded using the gene order parameter. This model type is still under development and not currently supported by the Resistance Gene Identifier (RGI) software. " 738 UPDATE AAC(6')-Iae 2'-N-ethylnetilmicin; 5-episisomicin; AAC(6'); aminoglycoside antibiotic; sisomicin; antibiotic inactivation; netilmicin; amikacin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. DELETED 35966 UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. " 226 UPDATE OXA-113 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5156 UPDATE OXA-859 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1598 UPDATE OXA-101 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 623 UPDATE OXA-68 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4945 UPDATE OXA-619 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1024 UPDATE AAC(6')-Ib-SK antibiotic inactivation; AAC(6'); kanamycin A; amikacin; aminoglycoside antibiotic; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. UPDATED category_aro_name with kanamycin A UPDATED category_aro_cvterm_id with 35966 UPDATED category_aro_accession with 0000049 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Kanamycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Kanamycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with amikacin UPDATED category_aro_cvterm_id with 35932 UPDATED category_aro_accession with 0000013 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Amikacin is an aminoglycoside antibiotic that works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with tobramycin UPDATED category_aro_cvterm_id with 35969 UPDATED category_aro_accession with 0000052 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Tobramycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Tobramycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. " 5121 UPDATE OXA-817 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1020 UPDATE OXA-241 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3379 UPDATE APH(3')-VIIIa kanamycin A; APH(3'); amikacin; aminoglycoside antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-phosphotransferase enzymes with modification regiospecificity based at the 3'-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics, specifically kanamycin and neomycin, by the ATP-dependent phosphorylation of the 3'-hydroxyl group of the compound. DELETED 36997 " 3378 UPDATE rmtE2 gentamicin; 16S rRNA methyltransferase (G1405); kanamycin A; antibiotic target alteration; amikacin; aminoglycoside antibiotic; gentamicin A; ARO_category "UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 3377 UPDATE rmtE gentamicin; 16S rRNA methyltransferase (G1405); antibiotic target alteration; amikacin; aminoglycoside antibiotic; gentamicin A; ARO_category "UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 3376 UPDATE rmtD2 gentamicin; 16S rRNA methyltransferase (G1405); kanamycin A; netilmicin; antibiotic target alteration; amikacin; aminoglycoside antibiotic; gentamicin A; tobramycin; ARO_category "UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 1184 UPDATE OXA-182 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3374 UPDATE aphA15 antibiotic inactivation; streptomycin; kanamycin A; APH(3'); netilmicin; amikacin; aminoglycoside antibiotic; neomycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-phosphotransferase enzymes with modification regiospecificity based at the 3'-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics, specifically kanamycin and neomycin, by the ATP-dependent phosphorylation of the 3'-hydroxyl group of the compound. DELETED 36997 " 3373 UPDATE FosD fosfomycin; fosfomycin thiol transferase; antibiotic inactivation; phosphonic acid antibiotic; ARO_category "UPDATED category_aro_name with fosfomycin UPDATED category_aro_cvterm_id with 35944 UPDATED category_aro_accession with 0000025 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Fosfomycin (also known as phosphomycin and phosphonomycin) is a broad-spectrum antibiotic produced by certain Streptomyces species. It is effective on gram positive and negative bacteria as it targets the cell wall, an essential feature shared by both bacteria. Its specific target is MurA (MurZ in E.coli), which attaches phosphoenolpyruvate (PEP) to UDP-N-acetylglucosamine, a step of commitment to cell wall synthesis. In the active site of MurA, the active cysteine molecule is alkylated which stops the catalytic reaction. " 3372 UPDATE FosB6 fosfomycin; fosfomycin thiol transferase; antibiotic inactivation; phosphonic acid antibiotic; ARO_category "UPDATED category_aro_name with fosfomycin UPDATED category_aro_cvterm_id with 35944 UPDATED category_aro_accession with 0000025 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Fosfomycin (also known as phosphomycin and phosphonomycin) is a broad-spectrum antibiotic produced by certain Streptomyces species. It is effective on gram positive and negative bacteria as it targets the cell wall, an essential feature shared by both bacteria. Its specific target is MurA (MurZ in E.coli), which attaches phosphoenolpyruvate (PEP) to UDP-N-acetylglucosamine, a step of commitment to cell wall synthesis. In the active site of MurA, the active cysteine molecule is alkylated which stops the catalytic reaction. " 3371 UPDATE FosB5 fosfomycin; fosfomycin thiol transferase; antibiotic inactivation; phosphonic acid antibiotic; ARO_category "UPDATED category_aro_name with fosfomycin UPDATED category_aro_cvterm_id with 35944 UPDATED category_aro_accession with 0000025 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Fosfomycin (also known as phosphomycin and phosphonomycin) is a broad-spectrum antibiotic produced by certain Streptomyces species. It is effective on gram positive and negative bacteria as it targets the cell wall, an essential feature shared by both bacteria. Its specific target is MurA (MurZ in E.coli), which attaches phosphoenolpyruvate (PEP) to UDP-N-acetylglucosamine, a step of commitment to cell wall synthesis. In the active site of MurA, the active cysteine molecule is alkylated which stops the catalytic reaction. " 3370 UPDATE FosB4 fosfomycin; fosfomycin thiol transferase; antibiotic inactivation; phosphonic acid antibiotic; ARO_category "UPDATED category_aro_name with fosfomycin UPDATED category_aro_cvterm_id with 35944 UPDATED category_aro_accession with 0000025 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Fosfomycin (also known as phosphomycin and phosphonomycin) is a broad-spectrum antibiotic produced by certain Streptomyces species. It is effective on gram positive and negative bacteria as it targets the cell wall, an essential feature shared by both bacteria. Its specific target is MurA (MurZ in E.coli), which attaches phosphoenolpyruvate (PEP) to UDP-N-acetylglucosamine, a step of commitment to cell wall synthesis. In the active site of MurA, the active cysteine molecule is alkylated which stops the catalytic reaction. " 2889 UPDATE TRU-1 penam; antibiotic inactivation; cephalosporin; cefalotin; TRU beta-lactamase; ARO_category "UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. " 1845 UPDATE OXA-312 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 724 UPDATE AAC(6')-Ij 2'-N-ethylnetilmicin; 5-episisomicin; AAC(6'); aminoglycoside antibiotic; sisomicin; antibiotic inactivation; netilmicin; amikacin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. DELETED 35966 UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. " 1386 UPDATE ANT(9)-Ia antibiotic inactivation; aminoglycoside antibiotic; spectinomycin; ANT(9); ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-nucleotidyltransferase enzymes with modification regiospecificity based at the 9-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics, specifically streptomycin, by transfer of an AMP group from an ATP substrate to the 9-hydroxyl group of the compound. " 721 UPDATE OXA-28 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1394 UPDATE OXA-257 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1741 UPDATE OXA-359 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1743 UPDATE OXA-338 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3444 UPDATE OXA-279 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 604 UPDATE OXA-385 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 600 UPDATE CMY-2 penam; carbapenem; cephalosporin; cefazolin; ceftazidime; cefalotin; cephamycin; cefixime; ampicillin; antibiotic inactivation; CMY beta-lactamase; ceftriaxone; cefoxitin; ertapenem; ARO_category "DELETED 35981 " 1162 UPDATE aadA15 antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-nucleotidyltransferase enzymes with modification regiospecificity based at the 3''-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics by transfer of an AMP group from an ATP substrate to the 3''-hydroxyl group of the compound. " 156 UPDATE AAC(6')-Iaf 2'-N-ethylnetilmicin; 5-episisomicin; AAC(6'); aminoglycoside antibiotic; sisomicin; antibiotic inactivation; netilmicin; amikacin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. DELETED 35966 UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. UPDATED category_aro_name with tobramycin UPDATED category_aro_cvterm_id with 35969 UPDATED category_aro_accession with 0000052 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Tobramycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Tobramycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. " 5058 UPDATE OXA-749 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 112 UPDATE fosA5 antibiotic inactivation; fosfomycin thiol transferase; gentamicin; phosphonic acid antibiotic; ciprofloxacin; fluoroquinolone antibiotic; aminoglycoside antibiotic; ARO_category "UPDATED category_aro_name with aminoglycoside antibiotic UPDATED category_aro_cvterm_id with 35935 UPDATED category_aro_accession with 0000016 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Aminoglycosides are a group of antibiotics that are mostly effective against Gram-negative bacteria. These molecules consist of aminated sugars attached to a dibasic cyclitol. Aminoglycosides work by binding to the bacterial 30S ribosomal subunit (some work by binding to the 50S subunit), inhibiting the translocation of the peptidyl-tRNA from the A-site to the P-site and also causing misreading of mRNA, leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with fluoroquinolone antibiotic UPDATED category_aro_cvterm_id with 35920 UPDATED category_aro_accession with 0000001 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with The fluoroquinolones are a family of synthetic broad-spectrum antibiotics that are 4-quinolone-3-carboxylates. These compounds interact with topoisomerase II (DNA gyrase) to disrupt bacterial DNA replication, damage DNA, and cause cell death. UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). UPDATED category_aro_name with ciprofloxacin UPDATED category_aro_cvterm_id with 35954 UPDATED category_aro_accession with 0000036 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Ciprofloxacin is a bacteriocidal fluoroquinolone. It blocks bacterial DNA replication by binding to the toposiomerase II or IV-DNA complex (or cleavable complex), thereby causing double-stranded breaks in the bacterial chromosome. " 608 UPDATE OXA-361 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1539 UPDATE aadA3 antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-nucleotidyltransferase enzymes with modification regiospecificity based at the 3''-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics by transfer of an AMP group from an ATP substrate to the 3''-hydroxyl group of the compound. " 1387 UPDATE OXA-99 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1898 UPDATE OXA-379 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4868 UPDATE OXA-533 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4959 UPDATE OXA-633 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3424 UPDATE OXA-234 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1891 UPDATE AAC(6')-Iih 2'-N-ethylnetilmicin; 5-episisomicin; AAC(6'); aminoglycoside antibiotic; sisomicin; antibiotic inactivation; netilmicin; amikacin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. UPDATED category_aro_name with amikacin UPDATED category_aro_cvterm_id with 35932 UPDATED category_aro_accession with 0000013 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Amikacin is an aminoglycoside antibiotic that works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with tobramycin UPDATED category_aro_cvterm_id with 35969 UPDATED category_aro_accession with 0000052 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Tobramycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Tobramycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. " 1892 UPDATE OXA-114a penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 635 UPDATE OXA-332 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4923 UPDATE OXA-597 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4922 UPDATE OXA-596 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4921 UPDATE OXA-595 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4920 UPDATE OXA-594 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4927 UPDATE OXA-601 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4926 UPDATE OXA-600 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4925 UPDATE OXA-599 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1347 UPDATE OXA-425 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5059 UPDATE OXA-750 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 47 UPDATE OXA-60 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4929 UPDATE OXA-603 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4928 UPDATE OXA-602 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4994 UPDATE OXA-682 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 958 UPDATE OXA-418 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 41 UPDATE rmtH gentamicin; 16S rRNA methyltransferase (G1405); arbekacin; antibiotic target alteration; amikacin; aminoglycoside antibiotic; gentamicin A; tobramycin; ARO_category "UPDATED category_aro_name with gentamicin UPDATED category_aro_cvterm_id with 46133 UPDATED category_aro_accession with 3007382 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Gentamicin is a commonly used aminoglycoside antibiotic derived from members of the Micromonospora genus of bacteria. It acts by binding the 30S ribosomal subunit, thus inhibiting protein synthesis. Gentamicin is typically used to treat Gram-negative infections of the repiratory and urinary tract, as well as infections of the bone and soft tissue. It also exhibits considerable nephrotoxicity and ototoxicity. Gentamicin is administered as a mixture of gentamicin type C (which makes about around 80% of the complex) and types A, B, and X (distributed in the remaining 20% of the complex). " 1111 UPDATE AAC(6')-Ig 2'-N-ethylnetilmicin; 5-episisomicin; AAC(6'); aminoglycoside antibiotic; sisomicin; antibiotic inactivation; netilmicin; amikacin; dibekacin; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. DELETED 35966 UPDATED category_aro_name with 2'-N-ethylnetilmicin UPDATED category_aro_cvterm_id with 46128 UPDATED category_aro_accession with 3007378 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 2'-N-ethylnetilmicin is an aminoglycoside antibiotic and a derivative of netilmicin. UPDATED category_aro_name with 5-episisomicin UPDATED category_aro_cvterm_id with 46129 UPDATED category_aro_accession with 3007379 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with 5-episosomicin is a semisynthetic aminoglycoside antibiotic similar to sisomicin. UPDATED category_aro_name with sisomicin UPDATED category_aro_cvterm_id with 35953 UPDATED category_aro_accession with 0000035 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Sisomicin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Sisomicin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with dibekacin UPDATED category_aro_cvterm_id with 35926 UPDATED category_aro_accession with 0000007 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Dibekacin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Dibekacin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_name with netilmicin UPDATED category_aro_cvterm_id with 35956 UPDATED category_aro_accession with 0000038 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Netilmicin is a member of the aminoglycoside family of antibiotics. These antibiotics have the ability to kill a wide variety of bacteria by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth. Netilmicin is not absorbed from the gut and is therefore only given by injection or infusion. It is only used in the treatment of serious infections particularly those resistant to gentamicin. " 2001 UPDATE OXA-250 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1113 UPDATE ANT(6)-Ib antibiotic inactivation; streptomycin; aminoglycoside antibiotic; ANT(6); ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-nucleotidyltransferase enzymes with modification regiospecificity based at the 6-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics, specifically streptomycin, by transfer of an AMP group from an ATP substrate to the 6-hydroxyl group of the compound. " 1112 UPDATE OXA-58 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1115 UPDATE OXA-435 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1352 UPDATE OXA-251 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1118 UPDATE OXA-2 penam; antibiotic inactivation; cephalosporin; carbapenem; ceftazidime; cefalotin; oxacillin; amoxicillin; ampicillin; cloxacillin; OXA beta-lactamase; meropenem; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1562 UPDATE aad(6) antibiotic inactivation; streptomycin; aminoglycoside antibiotic; ANT(6); ARO_category "UPDATED category_aro_description with A category of aminoglycoside O-nucleotidyltransferase enzymes with modification regiospecificity based at the 6-hydroxyl group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics, specifically streptomycin, by transfer of an AMP group from an ATP substrate to the 6-hydroxyl group of the compound. " 1449 UPDATE OXA-59 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2007 UPDATE OXA-335 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5160 UPDATE OXA-863 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5161 UPDATE OXA-864 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5162 UPDATE OXA-865 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5163 UPDATE OXA-866 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5164 UPDATE OXA-867 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5165 UPDATE OXA-868 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5166 UPDATE OXA-869 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4924 UPDATE OXA-598 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5168 UPDATE OXA-871 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5169 UPDATE OXA-872 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4991 UPDATE OXA-678 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4931 UPDATE OXA-605 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4046 UPDATE OXA-540 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 450 UPDATE OXA-51 penam; antibiotic inactivation; carbapenem; BAL30072; cephalosporin; cefalotin; oxacillin; monobactam; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5024 UPDATE OXA-712 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5734 UPDATE BioF carbapenem; antibiotic inactivation; PFM beta-lactamase; ARO_description; CARD_short_name; ARO_category; model_name; ARO_name "UPDATED ARO_description with PFM-4 (BioF) is a class B2 metallo-beta-lactamase first identified in Pseudomonas. It belongs to the PFM-like beta-lactamase gene family. It confers resistance to carbapenems and some cephalosporins. UPDATED CARD_short_name with PFM-4 DELETED 45491 UPDATED category_aro_name with PFM beta-lactamase UPDATED category_aro_cvterm_id with 43892 UPDATED category_aro_accession with 3005432 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with PFM beta-lactamases are class B2 beta-lactamases found in Pseudomonas fluorescens. UPDATED model_name with PFM-4 UPDATED ARO_name with PFM-4 " 5049 UPDATE OXA-740 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5048 UPDATE OXA-739 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5047 UPDATE OXA-738 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5046 UPDATE OXA-736 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5045 UPDATE OXA-735 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5044 UPDATE OXA-734 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5043 UPDATE OXA-733 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4960 UPDATE OXA-634 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5125 UPDATE OXA-822 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5040 UPDATE OXA-730 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1807 UPDATE OXA-70 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1806 UPDATE OXA-14 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3429 UPDATE OXA-262 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1804 UPDATE OXA-107 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1802 UPDATE OXA-168 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 1801 UPDATE AAC(6')-Ib11 antibiotic inactivation; AAC(6'); kanamycin A; amikacin; aminoglycoside antibiotic; tobramycin; ARO_category "UPDATED category_aro_description with A category of aminoglycoside N-acetyltransferase enzymes with modification regiospecificity based at the 6'-amino group of the respective antibiotic. These enzymes inactivate aminoglycoside antibiotics through acetylation of the 6-amino group of the compound. DELETED 40942 " 1860 UPDATE OXA-165 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5035 UPDATE OXA-723 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3422 UPDATE OXA-158 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3421 UPDATE OXA-157 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3420 UPDATE OXA-156 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3427 UPDATE OXA-260 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3426 UPDATE OXA-259 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 3425 UPDATE OXA-252 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4068 UPDATE OXA-915 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4996 UPDATE OXA-684 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4997 UPDATE OXA-685 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 470 UPDATE OXA-4 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4995 UPDATE OXA-683 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 5172 UPDATE OXA-875 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4993 UPDATE OXA-680 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4990 UPDATE OXA-677 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4858 UPDATE OXA-523 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4857 UPDATE OXA-522 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4856 UPDATE OXA-521 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4855 UPDATE OXA-520 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4051 UPDATE OXA-681 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4853 UPDATE OXA-518 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4852 UPDATE OXA-517 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4851 UPDATE OXA-516 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 4999 UPDATE OXA-687 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; oxacillin; cloxacillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with cloxacillin UPDATED category_aro_cvterm_id with 35930 UPDATED category_aro_accession with 0000011 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cloxacillin is a semisynthetic, isoxazolyl penicillin derivative in the beta-lactam class of antibiotics. It interferes with peptidogylcan synthesis and is commonly used for treating penicillin-resistant Staphylococcus aureus infections. UPDATED category_aro_name with cefalotin UPDATED category_aro_cvterm_id with 37084 UPDATED category_aro_accession with 3000704 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Cefalotin is a semisynthetic cephalosporin antibiotic activate against staphylococci. It is resistant to staphylococci beta-lactamases but hydrolyzed by enterobacterial beta-lactamases. UPDATED category_aro_name with oxacillin UPDATED category_aro_cvterm_id with 35973 UPDATED category_aro_accession with 0000056 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis. " 2200 DELETE APH(3')-VI antibiotic inactivation; aminoglycoside antibiotic; isepamicin; paromomycin; kanamycin A; APH(3'); gentamicin B; amikacin; ribostamycin; G418; neomycin; butirosin; N/A N/A 2317 DELETE mgrB resistance by absence; N/A N/A 5902 ADD KPC-87 penam; antibiotic inactivation; imipenem; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; meropenem; N/A N/A 5903 ADD KPC-86 penam; antibiotic inactivation; cephalosporin; carbapenem; ceftazidime; monobactam; KPC beta-lactamase; N/A N/A 5900 ADD FosBx1 fosfomycin; fosfomycin thiol transferase; antibiotic inactivation; phosphonic acid antibiotic; N/A N/A 5901 ADD PJM-1 penam; carbapenem; imipenem; PJM beta-lactamase; cefotaxime; cephalosporin; cefalotin; cephamycin; ampicillin; antibiotic inactivation; cefoxitin; N/A N/A 5906 ADD KPC-94 penam; antibiotic inactivation; ceftazidime; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; meropenem; N/A N/A 5907 ADD QnrAS sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; N/A N/A 5904 ADD KPC-95 penam; antibiotic inactivation; cephalosporin; carbapenem; ceftazidime; monobactam; KPC beta-lactamase; N/A N/A 5905 ADD ANT(9)-Ib antibiotic inactivation; aminoglycoside antibiotic; spectinomycin; ANT(9); N/A N/A 5908 ADD QnrB39 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; N/A N/A 5909 ADD QnrB75 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; N/A N/A 5854 ADD MCR-3.14 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5855 ADD MCR-3.37 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5856 ADD MCR-3.38 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5857 ADD MCR-3.15 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5919 ADD QnrB76 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; N/A N/A 5918 ADD kdpD kanamycin A; kdpDE; aminoglycoside antibiotic; protein(s) and two-component regulatory system modulating antibiotic efflux; antibiotic efflux; N/A N/A 5852 ADD MCR-1.25 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5853 ADD MCR-3.33 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5914 ADD cfrE oxazolidinone antibiotic; antibiotic target alteration; streptogramin antibiotic; phenicol antibiotic; Cfr 23S ribosomal RNA methyltransferase; lincosamide antibiotic; N/A N/A 5917 ADD Mrx antibiotic inactivation; macrolide phosphotransferase (MPH); macrolide antibiotic; N/A N/A 5916 ADD LnuH antibiotic inactivation; lincosamide nucleotidyltransferase (LNU); lincosamide antibiotic; N/A N/A 5911 ADD QnrB78 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; N/A N/A 5910 ADD QnrB77 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; N/A N/A 5912 ADD QnrB80 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; N/A N/A 5847 ADD MCR-1.30 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5846 ADD MCR-1.29 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5845 ADD MCR-1.19 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5844 ADD MCR-1.22 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5843 ADD MCR-1.16 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5842 ADD MCR-1.21 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5841 ADD MCR-1.28 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5840 ADD MCR-1.20 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5850 ADD MCR-1.31 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5849 ADD MCR-1.17 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5848 ADD MCR-1.24 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5858 ADD MCR-3.27 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5859 ADD MCR-3.32 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5872 ADD MCR-3.35 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5873 ADD MCR-3.34 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5870 ADD MCR-3.24 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5871 ADD MCR-3.20 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5876 ADD MCR-3.39 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5877 ADD MCR-3.29 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5874 ADD MCR-3.13 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5875 ADD MCR-3.28 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5878 ADD MCR-3.19 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5879 ADD MCR-10.5 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5869 ADD MCR-3.40 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5868 ADD MCR-3.18 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5865 ADD MCR-3.16 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5864 ADD MCR-3.22 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5867 ADD MCR-3.21 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5866 ADD MCR-3.26 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5861 ADD MCR-3.23 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5860 ADD MCR-3.31 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5863 ADD MCR-3.25 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5862 ADD MCR-3.36 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5890 ADD MCR-2.8 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5891 ADD MCR-2.5 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5892 ADD MCR-2.7 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5893 ADD MCR-2.6 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5894 ADD MCR-1.32 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5895 ADD FosXCC fosfomycin; fosfomycin thiol transferase; antibiotic inactivation; phosphonic acid antibiotic; N/A N/A 5896 ADD FosG fosfomycin; fosfomycin thiol transferase; antibiotic inactivation; phosphonic acid antibiotic; N/A N/A 5897 ADD FosH fosfomycin; fosfomycin thiol transferase; antibiotic inactivation; phosphonic acid antibiotic; N/A N/A 5898 ADD FosI fosfomycin; fosfomycin thiol transferase; antibiotic inactivation; phosphonic acid antibiotic; N/A N/A 5899 ADD FosA8 fosfomycin; fosfomycin thiol transferase; antibiotic inactivation; phosphonic acid antibiotic; N/A N/A 5883 ADD MCR-3.17 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5882 ADD MCR-10.2 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5881 ADD MCR-10.4 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5880 ADD MCR-10.3 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5887 ADD MCR-5.3 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5886 ADD MCR-5.4 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5885 ADD MCR-1.26 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5884 ADD MCR-1.15 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5889 ADD MCR-2.3 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5888 ADD MCR-2.4 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5924 ADD Klebsiella pneumoniae PBP3 mutants conferring resistance to ceftazidime-avibactam penam; cephalosporin; ceftazidime; cephamycin; antibiotic target alteration; Penicillin-binding protein mutations conferring resistance to beta-lactam antibiotics; N/A N/A 5926 ADD ThfT ECF transporter S component; sulfamethoxazole; resistance by host-dependent nutrient acquisition; sulfonamide antibiotic; N/A N/A 5927 ADD almF colistin B; alm glycyl carrier protein; colistin A; polymyxin resistance operon; peptide antibiotic; antibiotic target alteration; N/A N/A 5921 ADD leuO antibiotic efflux; major facilitator superfamily (MFS) antibiotic efflux pump; protein(s) and two-component regulatory system modulating antibiotic efflux; efflux pump complex or subunit conferring antibiotic resistance; puromycin; acriflavine; nucleoside antibiotic; disinfecting agents and antiseptics; N/A N/A 5923 ADD Klebsiella pneumoniae lamB with mutations conferring resistance to ceftazidime-avibactam cephalosporin; reduced permeability to antibiotic; Sugar Porin (SP); ceftazidime; tetracycline antibiotic; fluoroquinolone antibiotic; N/A N/A 5928 ADD almE alm glycyltransferase; colistin B; colistin A; polymyxin resistance operon; peptide antibiotic; antibiotic target alteration; N/A N/A 5929 ADD almEFG peptide antibiotic; antibiotic target alteration; colistin B; colistin A; polymyxin resistance operon; N/A N/A 5851 ADD MCR-1.14 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5836 ADD MCR-4.6 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5837 ADD MCR-1.27 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5834 ADD MCR-8.2 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5835 ADD MCR-1.34 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5832 ADD MCR-8.3 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5833 ADD MCR-8.4 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5838 ADD MCR-1.18 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A 5839 ADD MCR-1.23 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; N/A N/A