Model_id Action ARO_name ARO_category Changes To Summary 965 UPDATE OXA-333 antibiotic inactivation; penam; OXA-211-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-211-like beta-lactamase UPDATED category_aro_cvterm_id with 46494 UPDATED category_aro_accession with 3007705 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-211. " 4607 UPDATE FOX-17 antibiotic inactivation; cephamycin; cephalosporin; FOX beta-lactamase; model_sequences "UPDATED fmin with 0 " 343 UPDATE OXA-31 penam; antibiotic inactivation; OXA-1-like beta-lactamase; cephalosporin; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-1-like beta-lactamase UPDATED category_aro_cvterm_id with 46485 UPDATED category_aro_accession with 3007696 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-1. " 4930 UPDATE OXA-604 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 4931 UPDATE OXA-605 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 4932 UPDATE OXA-606 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 4933 UPDATE OXA-607 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 4934 UPDATE OXA-608 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 4935 UPDATE OXA-609 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 4732 UPDATE KPC-73 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; model_sequences "UPDATED fmin with 0 " 4733 UPDATE KPC-74 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; model_sequences "UPDATED fmin with 0 " 4730 UPDATE KPC-71 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; model_sequences "UPDATED fmin with 0 " 4731 UPDATE KPC-72 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; model_sequences "UPDATED fmin with 0 " 4736 UPDATE KPC-77 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; model_sequences "UPDATED fmin with 0 " 4737 UPDATE KPC-78 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; model_sequences "UPDATED fmin with 0 " 4734 UPDATE KPC-75 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; model_sequences "UPDATED fmin with 0 " 4735 UPDATE KPC-76 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; model_sequences "UPDATED fmin with 100 " 4738 UPDATE KPC-79 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; model_sequences "UPDATED fmin with 100 " 4739 UPDATE KPC-80 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; model_sequences "UPDATED fmin with 0 " 4831 UPDATE OXA-493 penam; OXA-493-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 100 DELETED 35939 UPDATED category_aro_name with OXA-493-like beta-lactamase UPDATED category_aro_cvterm_id with 46511 UPDATED category_aro_accession with 3007722 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-493. " 4526 UPDATE CTX-M-197 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 295 UPDATE OXA-145 penam; OXA-10-like beta-lactamase; cephalosporin; antibiotic inactivation; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-10-like beta-lactamase UPDATED category_aro_cvterm_id with 46486 UPDATED category_aro_accession with 3007697 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-10. " 4833 UPDATE OXA-497 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 100 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4832 UPDATE OXA-494 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; OXA-50-like beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 100 DELETED 35939 UPDATED category_aro_name with OXA-50-like beta-lactamase UPDATED category_aro_cvterm_id with 46513 UPDATED category_aro_accession with 3007724 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-50. " 4835 UPDATE OXA-500 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 4834 UPDATE OXA-498 antibiotic inactivation; penam; OXA-211-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 100 DELETED 35930 UPDATED category_aro_name with OXA-211-like beta-lactamase UPDATED category_aro_cvterm_id with 46494 UPDATED category_aro_accession with 3007705 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-211. " 4655 UPDATE GOB-42 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 4654 UPDATE GOB-41 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 4657 UPDATE GOB-44 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 4656 UPDATE GOB-43 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 274 UPDATE OXA-174 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4650 UPDATE GOB-37 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 4653 UPDATE GOB-40 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 4652 UPDATE GOB-39 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 4836 UPDATE OXA-501 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 4659 UPDATE GOB-46 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 4658 UPDATE GOB-45 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 962 UPDATE OXA-356 antibiotic inactivation; penam; OXA-229-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-229-like beta-lactamase UPDATED category_aro_cvterm_id with 46498 UPDATED category_aro_accession with 3007709 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-229. " 104 UPDATE OXA-61 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 4813 UPDATE OXA-114m OXA-114-like beta-lactamase; penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-114-like beta-lactamase UPDATED category_aro_cvterm_id with 46487 UPDATED category_aro_accession with 3007698 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-114. " 4812 UPDATE OXA-114l OXA-114-like beta-lactamase; penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-114-like beta-lactamase UPDATED category_aro_cvterm_id with 46487 UPDATED category_aro_accession with 3007698 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-114. " 4811 UPDATE OXA-114k OXA-114-like beta-lactamase; penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-114-like beta-lactamase UPDATED category_aro_cvterm_id with 46487 UPDATED category_aro_accession with 3007698 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-114. " 4810 UPDATE OXA-114j OXA-114-like beta-lactamase; penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-114-like beta-lactamase UPDATED category_aro_cvterm_id with 46487 UPDATED category_aro_accession with 3007698 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-114. " 4817 UPDATE OXA-114r OXA-114-like beta-lactamase; penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-114-like beta-lactamase UPDATED category_aro_cvterm_id with 46487 UPDATED category_aro_accession with 3007698 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-114. " 4816 UPDATE OXA-114q OXA-114-like beta-lactamase; penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-114-like beta-lactamase UPDATED category_aro_cvterm_id with 46487 UPDATED category_aro_accession with 3007698 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-114. " 4815 UPDATE OXA-114p OXA-114-like beta-lactamase; penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-114-like beta-lactamase UPDATED category_aro_cvterm_id with 46487 UPDATED category_aro_accession with 3007698 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-114. " 2041 UPDATE OXA-424 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4819 UPDATE OXA-114t OXA-114-like beta-lactamase; penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-114-like beta-lactamase UPDATED category_aro_cvterm_id with 46487 UPDATED category_aro_accession with 3007698 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-114. " 4818 UPDATE OXA-114s OXA-114-like beta-lactamase; penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-114-like beta-lactamase UPDATED category_aro_cvterm_id with 46487 UPDATED category_aro_accession with 3007698 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-114. " 2048 UPDATE OXA-57 penam; OXA-42-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-42-like beta-lactamase UPDATED category_aro_cvterm_id with 46507 UPDATED category_aro_accession with 3007718 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-42. " 3519 UPDATE OXA-450 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 3518 UPDATE OXA-449 penam; OXA-184-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-184-like beta-lactamase UPDATED category_aro_cvterm_id with 46491 UPDATED category_aro_accession with 3007702 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-184. " 3513 UPDATE OXA-443 penam; antibiotic inactivation; OXA-22-like beta-lactamase; cephalosporin; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-22-like beta-lactamase UPDATED category_aro_cvterm_id with 46497 UPDATED category_aro_accession with 3007708 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-22. " 3512 UPDATE OXA-442 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 3511 UPDATE OXA-441 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 3510 UPDATE OXA-440 antibiotic inactivation; penam; OXA-23-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-23-like beta-lactamase UPDATED category_aro_cvterm_id with 46499 UPDATED category_aro_accession with 3007710 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases, specifically imipenem, derived from OXA-23, first identified in Acinetobacter baumannii. " 3517 UPDATE OXA-448 penam; OXA-184-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-184-like beta-lactamase UPDATED category_aro_cvterm_id with 46491 UPDATED category_aro_accession with 3007702 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-184. " 3516 UPDATE OXA-447 penam; OXA-184-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-184-like beta-lactamase UPDATED category_aro_cvterm_id with 46491 UPDATED category_aro_accession with 3007702 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-184. " 3515 UPDATE OXA-446 penam; OXA-184-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-184-like beta-lactamase UPDATED category_aro_cvterm_id with 46491 UPDATED category_aro_accession with 3007702 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-184. " 3514 UPDATE OXA-444 penam; antibiotic inactivation; OXA-60-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-60-like beta-lactamase UPDATED category_aro_cvterm_id with 46518 UPDATED category_aro_accession with 3007729 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-60. " 96 UPDATE OXA-426 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5182 UPDATE OXA-885 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 42 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5183 UPDATE OXA-886 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 11 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5180 UPDATE OXA-883 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 11 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5181 UPDATE OXA-884 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 12 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5186 UPDATE OXA-889 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 45 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5187 UPDATE OXA-890 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 31 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 1625 UPDATE OXA-179 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5185 UPDATE OXA-888 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 32 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5188 UPDATE OXA-891 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 15 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5189 UPDATE OXA-892 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 30 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5058 UPDATE OXA-749 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 29 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5059 UPDATE OXA-750 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 14 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 555 UPDATE OXA-133 antibiotic inactivation; penam; OXA-23-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-23-like beta-lactamase UPDATED category_aro_cvterm_id with 46499 UPDATED category_aro_accession with 3007710 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases, specifically imipenem, derived from OXA-23, first identified in Acinetobacter baumannii. " 554 UPDATE OXA-163 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 5054 UPDATE OXA-745 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 33 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5055 UPDATE OXA-746 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 23 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5458 UPDATE PDC-329 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5459 UPDATE PDC-33 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 100 " 5450 UPDATE PDC-32 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 1190 UPDATE OXA-354 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 5452 UPDATE PDC-321 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5453 UPDATE PDC-322 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5454 UPDATE PDC-325 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 1194 UPDATE OXA-16 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 " 5456 UPDATE PDC-327 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 1196 UPDATE OXA-71 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 1758 UPDATE OXA-326 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 1750 UPDATE OXA-254 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4259 UPDATE ADC-194 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4258 UPDATE ADC-193 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 1172 UPDATE OXA-194 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4251 UPDATE ADC-186 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4250 UPDATE ADC-185 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4253 UPDATE ADC-188 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4252 UPDATE ADC-187 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4255 UPDATE ADC-190 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4254 UPDATE ADC-189 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4257 UPDATE ADC-192 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4256 UPDATE ADC-191 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 5533 UPDATE PDC-403 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5532 UPDATE PDC-402 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5531 UPDATE PDC-401 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5530 UPDATE PDC-400 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5537 UPDATE PDC-407 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5536 UPDATE PDC-406 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5535 UPDATE PDC-405 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5534 UPDATE PDC-404 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5539 UPDATE PDC-409 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5538 UPDATE PDC-408 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 1281 UPDATE OXA-110 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 1288 UPDATE OXA-82 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 685 UPDATE OXA-239 antibiotic inactivation; penam; OXA-23-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-23-like beta-lactamase UPDATED category_aro_cvterm_id with 46499 UPDATED category_aro_accession with 3007710 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases, specifically imipenem, derived from OXA-23, first identified in Acinetobacter baumannii. " 1572 UPDATE OXA-205 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; OXA-46-like beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-46-like beta-lactamase UPDATED category_aro_cvterm_id with 46509 UPDATED category_aro_accession with 3007720 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-46. " 686 UPDATE OXA-162 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 1576 UPDATE OXA-17 penam; OXA-10-like beta-lactamase; cephalosporin; antibiotic inactivation; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-10-like beta-lactamase UPDATED category_aro_cvterm_id with 46486 UPDATED category_aro_accession with 3007697 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-10. " 1575 UPDATE OXA-91 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4189 UPDATE ADC-115 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4389 UPDATE BlaB-28 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences "UPDATED fmin with 100 " 4388 UPDATE BlaB-27 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences "UPDATED fmin with 100 " 5629 UPDATE PLN-1 carbapenem; antibiotic inactivation; PLN beta-lactamase; model_sequences "UPDATED fmin with 100 " 5628 UPDATE PLA-6 carbapenem; antibiotic inactivation; cephalosporin; PLA beta-lactamase; model_sequences "UPDATED fmin with 100 " 4383 UPDATE BlaB-22 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences "UPDATED fmin with 100 " 4382 UPDATE BlaB-20 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences "UPDATED fmin with 100 " 4381 UPDATE BlaB-2 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences "UPDATED fmin with 100 " 5624 UPDATE PFM-3 carbapenem; antibiotic inactivation; PFM beta-lactamase; model_sequences "UPDATED fmin with 0 " 4387 UPDATE BlaB-26 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences "UPDATED fmin with 100 " 4386 UPDATE BlaB-25 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences "UPDATED fmin with 100 " 4385 UPDATE BlaB-24 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences "UPDATED fmin with 100 " 4384 UPDATE BlaB-23 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences "UPDATED fmin with 100 " 407 UPDATE OXA-352 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 450 UPDATE OXA-51 penam; OXA-51-like beta-lactamase; carbapenem; BAL30072; antibiotic inactivation; oxacillin; monobactam; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 405 UPDATE OXA-202 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 404 UPDATE OXA-217 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 1341 UPDATE OXA-53 penam; antibiotic inactivation; OXA-2-like beta-lactamase; cephalosporin; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-2-like beta-lactamase UPDATED category_aro_cvterm_id with 46493 UPDATED category_aro_accession with 3007704 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-2. " 1379 UPDATE OXA-313 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4848 UPDATE OXA-513 penam; antibiotic inactivation; OXA-364-like beta-lactamase; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-364-like beta-lactamase UPDATED category_aro_cvterm_id with 46505 UPDATED category_aro_accession with 3007716 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-364. " 408 UPDATE OXA-380 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4594 UPDATE EC-5 EC beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 457 UPDATE OXA-93 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4598 UPDATE EFM-1 carbapenem; antibiotic inactivation; EFM beta-lactamase; model_sequences "UPDATED fmin with 0 " 4599 UPDATE ELM-1 carbapenem; antibiotic inactivation; ELM beta-lactamase; model_sequences "UPDATED fmin with 0 " 379 UPDATE OXA-148 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4349 UPDATE ADC-93 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4348 UPDATE ADC-92 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 397 UPDATE OXA-357 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 394 UPDATE OXA-130 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5669 UPDATE TEM-99 penam; antibiotic inactivation; penem; cephalosporin; ceftazidime; monobactam; ampicillin; TEM beta-lactamase; model_sequences "UPDATED fmin with 0 " 5668 UPDATE TEM-98 penam; antibiotic inactivation; penem; cephalosporin; ceftazidime; monobactam; ampicillin; TEM beta-lactamase; model_sequences "UPDATED fmin with 0 " 4729 UPDATE KPC-66 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; model_sequences "UPDATED fmin with 0 " 4728 UPDATE KPC-65 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; model_sequences "UPDATED fmin with 0 " 4725 UPDATE KPC-62 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; model_sequences "UPDATED fmin with 0 " 4724 UPDATE KPC-61 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; model_sequences "UPDATED fmin with 0 " 4727 UPDATE KPC-64 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; model_sequences "UPDATED fmin with 0 " 4726 UPDATE KPC-63 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; model_sequences "UPDATED fmin with 0 " 4721 UPDATE KPC-58 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; model_sequences "UPDATED fmin with 0 " 4720 UPDATE KPC-44 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; model_sequences "UPDATED fmin with 0 " 4723 UPDATE KPC-60 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; model_sequences "UPDATED fmin with 0 " 4722 UPDATE KPC-59 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; model_sequences "UPDATED fmin with 0 " 4620 UPDATE GES-37 carbapenem; penam; cephalosporin; antibiotic inactivation; GES beta-lactamase; model_sequences "UPDATED fmin with 0 " 4621 UPDATE GES-38 carbapenem; penam; cephalosporin; antibiotic inactivation; GES beta-lactamase; model_sequences "UPDATED fmin with 0 " 4622 UPDATE GES-39 carbapenem; penam; cephalosporin; antibiotic inactivation; GES beta-lactamase; model_sequences "UPDATED fmin with 0 " 4623 UPDATE GES-40 carbapenem; penam; cephalosporin; antibiotic inactivation; GES beta-lactamase; model_sequences "UPDATED fmin with 0 " 4624 UPDATE GES-41 carbapenem; penam; cephalosporin; antibiotic inactivation; GES beta-lactamase; model_sequences "UPDATED fmin with 0 " 4625 UPDATE GES-42 carbapenem; penam; cephalosporin; antibiotic inactivation; GES beta-lactamase; model_sequences "UPDATED fmin with 0 " 4626 UPDATE GES-43 carbapenem; penam; cephalosporin; antibiotic inactivation; GES beta-lactamase; model_sequences "UPDATED fmin with 0 " 4627 UPDATE GES-44 carbapenem; penam; cephalosporin; antibiotic inactivation; GES beta-lactamase; model_sequences "UPDATED fmin with 0 " 4628 UPDATE GES-45 carbapenem; penam; cephalosporin; antibiotic inactivation; GES beta-lactamase; model_sequences "UPDATED fmin with 0 " 4629 UPDATE GES-46 carbapenem; penam; cephalosporin; antibiotic inactivation; GES beta-lactamase; model_sequences "UPDATED fmin with 0 " 178 UPDATE vanH gene in vanA cluster vanH; glycopeptide resistance gene cluster; teicoplanin; glycopeptide antibiotic; antibiotic target alteration; vancomycin; model_sequences "UPDATED fmin with 6017 " 2050 UPDATE OXA-331 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 4538 UPDATE CTX-M-209 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4539 UPDATE CTX-M-210 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4828 UPDATE OXA-396 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; OXA-50-like beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-50-like beta-lactamase UPDATED category_aro_cvterm_id with 46513 UPDATED category_aro_accession with 3007724 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-50. " 4829 UPDATE OXA-489 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 100 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 4826 UPDATE OXA-307 penam; antibiotic inactivation; OXA-286-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 100 DELETED 35930 UPDATED category_aro_name with OXA-286-like beta-lactamase UPDATED category_aro_cvterm_id with 46503 UPDATED category_aro_accession with 3007714 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-286. " 4535 UPDATE CTX-M-206 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4824 UPDATE OXA-159 antibiotic inactivation; penam; OXA-62-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 100 DELETED 35930 UPDATED category_aro_name with OXA-62-like beta-lactamase UPDATED category_aro_cvterm_id with 46520 UPDATED category_aro_accession with 3007731 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-62. " 4825 UPDATE OXA-193 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 100 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 4822 UPDATE OXA-114w OXA-114-like beta-lactamase; penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-114-like beta-lactamase UPDATED category_aro_cvterm_id with 46487 UPDATED category_aro_accession with 3007698 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-114. " 4531 UPDATE CTX-M-202 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4532 UPDATE CTX-M-203 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4821 UPDATE OXA-114v OXA-114-like beta-lactamase; penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-114-like beta-lactamase UPDATED category_aro_cvterm_id with 46487 UPDATED category_aro_accession with 3007698 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-114. " 3526 UPDATE OXA-459 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 " 3527 UPDATE OXA-460 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 3524 UPDATE OXA-457 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 " 3525 UPDATE OXA-458 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 " 3522 UPDATE OXA-453 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 3523 UPDATE OXA-455 penam; antibiotic inactivation; OXA-364-like beta-lactamase; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-364-like beta-lactamase UPDATED category_aro_cvterm_id with 46505 UPDATED category_aro_accession with 3007716 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-364. " 3520 UPDATE OXA-451 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 3521 UPDATE OXA-452 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 3528 UPDATE OXA-461 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 3529 UPDATE OXA-464 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 " 4651 UPDATE GOB-38 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 5199 UPDATE OXA-907 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; OXA-50-like beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-50-like beta-lactamase UPDATED category_aro_cvterm_id with 46513 UPDATED category_aro_accession with 3007724 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-50. " 5198 UPDATE OXA-905 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; OXA-50-like beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-50-like beta-lactamase UPDATED category_aro_cvterm_id with 46513 UPDATED category_aro_accession with 3007724 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-50. " 1618 UPDATE OXA-362 penam; antibiotic inactivation; OXA-134-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-134-like beta-lactamase UPDATED category_aro_cvterm_id with 46489 UPDATED category_aro_accession with 3007700 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-134. " 5195 UPDATE OXA-902 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; OXA-50-like beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-50-like beta-lactamase UPDATED category_aro_cvterm_id with 46513 UPDATED category_aro_accession with 3007724 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-50. " 5194 UPDATE OXA-901 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; OXA-50-like beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-50-like beta-lactamase UPDATED category_aro_cvterm_id with 46513 UPDATED category_aro_accession with 3007724 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-50. " 5197 UPDATE OXA-904 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; OXA-50-like beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-50-like beta-lactamase UPDATED category_aro_cvterm_id with 46513 UPDATED category_aro_accession with 3007724 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-50. " 1967 UPDATE OXA-116 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 " 5191 UPDATE OXA-894 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 5190 UPDATE OXA-893 antibiotic inactivation; penam; OXA-23-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-23-like beta-lactamase UPDATED category_aro_cvterm_id with 46499 UPDATED category_aro_accession with 3007710 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases, specifically imipenem, derived from OXA-23, first identified in Acinetobacter baumannii. " 1610 UPDATE OXA-74 penam; OXA-10-like beta-lactamase; cephalosporin; antibiotic inactivation; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-10-like beta-lactamase UPDATED category_aro_cvterm_id with 46486 UPDATED category_aro_accession with 3007697 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-10. " 5192 UPDATE OXA-896 OXA-9-like beta-lactamase; penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-9-like beta-lactamase UPDATED category_aro_cvterm_id with 46524 UPDATED category_aro_accession with 3007735 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-9. " 2877 UPDATE OXA-535 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 2876 UPDATE OXA-436 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 3356 UPDATE OXA-296 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 " 5449 UPDATE PDC-319 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5448 UPDATE PDC-318 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5443 UPDATE PDC-312 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5442 UPDATE PDC-311 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5441 UPDATE PDC-310 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5440 UPDATE PDC-31 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5447 UPDATE PDC-317 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5446 UPDATE PDC-316 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5445 UPDATE PDC-315 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5444 UPDATE PDC-314 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 1761 UPDATE OXA-351 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 1764 UPDATE OXA-97 penam; antibiotic inactivation; OXA-58-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-58-like beta-lactamase UPDATED category_aro_cvterm_id with 46517 UPDATED category_aro_accession with 3007728 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-58. " 1765 UPDATE OXA-56 penam; OXA-10-like beta-lactamase; cephalosporin; antibiotic inactivation; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-10-like beta-lactamase UPDATED category_aro_cvterm_id with 46486 UPDATED category_aro_accession with 3007697 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-10. " 1143 UPDATE OXA-7 penam; OXA-10-like beta-lactamase; cephalosporin; antibiotic inactivation; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-10-like beta-lactamase UPDATED category_aro_cvterm_id with 46486 UPDATED category_aro_accession with 3007697 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-10. " 1141 UPDATE OXA-169 antibiotic inactivation; penam; OXA-23-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-23-like beta-lactamase UPDATED category_aro_cvterm_id with 46499 UPDATED category_aro_accession with 3007710 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases, specifically imipenem, derived from OXA-23, first identified in Acinetobacter baumannii. " 1148 UPDATE OXA-363 penam; antibiotic inactivation; OXA-134-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-134-like beta-lactamase UPDATED category_aro_cvterm_id with 46489 UPDATED category_aro_accession with 3007700 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-134. " 5508 UPDATE PDC-378 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5509 UPDATE PDC-379 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5506 UPDATE PDC-375 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5507 UPDATE PDC-377 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5504 UPDATE PDC-373 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5505 UPDATE PDC-374 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 100 " 5502 UPDATE PDC-371 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5503 UPDATE PDC-372 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5500 UPDATE PDC-37 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5501 UPDATE PDC-370 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 693 UPDATE OXA-22 penam; antibiotic inactivation; OXA-22-like beta-lactamase; cephalosporin; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-22-like beta-lactamase UPDATED category_aro_cvterm_id with 46497 UPDATED category_aro_accession with 3007708 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-22. " 690 UPDATE OXA-347 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 " 5618 UPDATE PER-15 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; PER beta-lactamase; monobactam; model_sequences "UPDATED fmin with 0 " 5619 UPDATE PER-16 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; PER beta-lactamase; monobactam; model_sequences "UPDATED fmin with 0 " 5612 UPDATE PDC-99 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5613 UPDATE PER-10 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; PER beta-lactamase; monobactam; model_sequences "UPDATED fmin with 100 " 5610 UPDATE PDC-97 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5611 UPDATE PDC-98 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5616 UPDATE PER-13 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; PER beta-lactamase; monobactam; model_sequences "UPDATED fmin with 0 " 5617 UPDATE PER-14 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; PER beta-lactamase; monobactam; model_sequences "UPDATED fmin with 0 " 5614 UPDATE PER-11 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; PER beta-lactamase; monobactam; model_sequences "UPDATED fmin with 100 " 5615 UPDATE PER-12 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; PER beta-lactamase; monobactam; model_sequences "UPDATED fmin with 100 " 414 UPDATE OXA-377 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 416 UPDATE OXA-204 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 412 UPDATE OXA-117 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5716 UPDATE VIM-67 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; model_sequences "UPDATED fmin with 0 " 1384 UPDATE OXA-382 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 1387 UPDATE OXA-99 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 418 UPDATE OXA-325 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 3827 UPDATE OXA-898 penam; antibiotic inactivation; OXA-60-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-60-like beta-lactamase UPDATED category_aro_cvterm_id with 46518 UPDATED category_aro_accession with 3007729 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-60. " 3826 UPDATE OXA-899 penam; antibiotic inactivation; OXA-22-like beta-lactamase; cephalosporin; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-22-like beta-lactamase UPDATED category_aro_cvterm_id with 46497 UPDATED category_aro_accession with 3007708 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-22. " 3825 UPDATE RanA efflux pump complex or subunit conferring antibiotic resistance; ATP-binding cassette (ABC) antibiotic efflux pump; aminoglycoside antibiotic; antibiotic efflux; ARO_category "DELETED 35946 " 3824 UPDATE RanB efflux pump complex or subunit conferring antibiotic resistance; ATP-binding cassette (ABC) antibiotic efflux pump; aminoglycoside antibiotic; antibiotic efflux; ARO_category "DELETED 35946 " 4282 UPDATE ADC-217 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 86 " 4283 UPDATE ADC-218 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 99 " 4280 UPDATE ADC-215 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 86 " 4281 UPDATE ADC-216 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4286 UPDATE ADC-221 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4287 UPDATE ADC-222 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4284 UPDATE ADC-219 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4285 UPDATE ADC-220 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 86 " 4288 UPDATE ADC-223 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4289 UPDATE ADC-224 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 361 UPDATE OXA-278 penam; antibiotic inactivation; OXA-134-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-134-like beta-lactamase UPDATED category_aro_cvterm_id with 46489 UPDATED category_aro_accession with 3007700 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-134. " 5276 UPDATE PDC-139 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 385 UPDATE OXA-46 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; OXA-46-like beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-46-like beta-lactamase UPDATED category_aro_cvterm_id with 46509 UPDATED category_aro_accession with 3007720 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-46. " 4758 UPDATE LUT-5 antibiotic inactivation; LUT beta-lactamase; cephalosporin; model_sequences "UPDATED fmin with 0 " 4759 UPDATE LUT-6 antibiotic inactivation; LUT beta-lactamase; cephalosporin; model_sequences "UPDATED fmin with 0 " 4750 UPDATE LHK-5 carbapenem; antibiotic inactivation; cephalosporin; LHK beta-lactamase; model_sequences "UPDATED fmin with 0 " 4751 UPDATE LHK-6 carbapenem; antibiotic inactivation; cephalosporin; LHK beta-lactamase; model_sequences "UPDATED fmin with 0 " 4752 UPDATE LRG-1 antibiotic inactivation; cephalosporin; LRG beta-lactamase; model_sequences "UPDATED fmin with 100 " 4753 UPDATE LUS-1 LUS beta-lactamase; carbapenem; cephalosporin; antibiotic inactivation; model_sequences "UPDATED fmin with 100 " 4754 UPDATE LUT-1 antibiotic inactivation; LUT beta-lactamase; cephalosporin; model_sequences "UPDATED fmin with 0 " 4755 UPDATE LUT-2 antibiotic inactivation; LUT beta-lactamase; cephalosporin; model_sequences "UPDATED fmin with 0 " 4756 UPDATE LUT-3 antibiotic inactivation; LUT beta-lactamase; cephalosporin; model_sequences "UPDATED fmin with 0 " 4757 UPDATE LUT-4 antibiotic inactivation; LUT beta-lactamase; cephalosporin; model_sequences "UPDATED fmin with 0 " 5871 UPDATE MCR-3.20 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; model_sequences "UPDATED partial with 0 UPDATED sequence with TTGTTTGATCAAAACATGATTCAGAATATTTTTGAAACCAATCAAAATGAGGCGTTAGCATATTTAAGCTTACCAATTATAGTATGGGTTACTATTGCTGGTTTTATCCCTGCCATTTTACTTTTCTTTGTTGAAATTGAATATGAGGAAAAATGGTTCAAAGGGATTCTAACTCGTGCCCTATCGATGTTTGCATCACTTATAGTGATTGCGGTTATTGCAGCACTATACTATCAAGATTATGTGTCAGTGGGGCGCAACAATTCAAACCTCCAGCGTGAGATTGTTCCAGCCAATTTCGTTAATAGTACCGTTAAATACGTTTACAATCGTTATCTTGCTGAACCAATCCCATTTACAACTTTAGGTGATGATGCAAAACGGGATACTAATCAAAGTAAGCCCACGTTGATGTTTCTGGTCGTTGGTGAAACCGCTCGTGGTAAAAATTTCTCGATGAATGGCTATGAGAAAGACACCAATCCATTTACCAGTAAATCTGGTGGCGTGATCTCCTTTAATGATGTTCGTTCGTGTGGGACTGCAACCGCTGTATCCGTCCCCTGCATGTTCTCCAATATGGGGAGAAAGGAGTTTGATGAAAATCGCGCTCGCAATAGCGAGGGCCTGCTAGATGTGTTGCAAAAAACGGGGATCTCCATTTTTTGGAAGGAGAACGATGGAGGCTGCAAAGGCGTCTGCGACCGAGTACCTAACATCGAAATCGAACCAAAGGATCACCCTAAGTTCTGCGATAAAAACACATGCTATGACGAGGTTGTCCTTCAAGACCTCGATAGTGAAATTGCTCAAATGAAAGGGGATAAGCTGGTTGGCTTCCACCTGATAGGTAGCCATGGCCCAACCTACTACAAGCGCTACCCTGATGCTCATCGTCAGTTCACCCCTGACTGTCCACGCAGTGATATTGAAAACTGCACAGATGAAGAGCTCACCAACACCTATGACAACACCATCCGCTACACCGATTTCGTGATTGGAGAGATGATTGCCAAGTTGAAAACCTACGAAGATAAGTACAACACCGCGTTGCTCTACGTCTCCGATCATGGTGAATCACTGGGAGCATTAGGGCTTTACCTACACGGTACACCGTACCAGTTTGCACCGGATGATCAGACCCGTGTTCCTATGCAGGTGTGGATGTCACCTGGATTTACCAAAGAGAAAGGCGTTGATATGGCGTGTTTGCAGCAGAAAGCCGCTGATACTCGTTACTCACACGATAATATTTTCTCATCTGTATTGGGTATCTGGGACGTCAAAACATCAGTTTACGAAAAGGGTCTAGATATTTTCAGTCAATGTCGTAATGTTCAATAA UPDATED fmax with 5516 UPDATED accession with LC549806.1 UPDATED fmin with 4172 UPDATED strand with + UPDATED NCBI_taxonomy_name with Escherichia coli UPDATED NCBI_taxonomy_id with 562 UPDATED NCBI_taxonomy_cvterm_id with 35914 UPDATED accession with BCG06510.1 UPDATED sequence with MFDQNMIQNIFETNQNEALAYLSLPIIVWVTIAGFIPAILLFFVEIEYEEKWFKGILTRALSMFASLIVIAVIAALYYQDYVSVGRNNSNLQREIVPANFVNSTVKYVYNRYLAEPIPFTTLGDDAKRDTNQSKPTLMFLVVGETARGKNFSMNGYEKDTNPFTSKSGGVISFNDVRSCGTATAVSVPCMFSNMGRKEFDENRARNSEGLLDVLQKTGISIFWKENDGGCKGVCDRVPNIEIEPKDHPKFCDKNTCYDEVVLQDLDSEIAQMKGDKLVGFHLIGSHGPTYYKRYPDAHRQFTPDCPRSDIENCTDEELTNTYDNTIRYTDFVIGEMIAKLKTYEDKYNTALLYVSDHGESLGALGLYLHGTPYQFAPDDQTRVPMQVWMSPGFTKEKGVDMACLQQKAADTRYSHDNIFSSVLGIWDVKTSVYEKGLDIFSQCRNVQ " 1077 UPDATE OXA-420 penam; antibiotic inactivation; OXA-58-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-58-like beta-lactamase UPDATED category_aro_cvterm_id with 46517 UPDATED category_aro_accession with 3007728 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-58. " 1072 UPDATE OXA-37 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 " 4633 UPDATE GOB-20 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 4632 UPDATE GOB-19 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 0 " 258 UPDATE OXA-208 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4630 UPDATE GIL-1 carbapenem; antibiotic inactivation; cephalosporin; GIL beta-lactamase; model_sequences "UPDATED fmin with 100 " 4637 UPDATE GOB-24 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 4636 UPDATE GOB-23 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 4635 UPDATE GOB-22 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 4634 UPDATE GOB-21 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 4639 UPDATE GOB-26 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 4638 UPDATE GOB-25 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 254 UPDATE OXA-150 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 2047 UPDATE OXA-322 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 160 UPDATE OXA-236 penam; antibiotic inactivation; OXA-134-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-134-like beta-lactamase UPDATED category_aro_cvterm_id with 46489 UPDATED category_aro_accession with 3007700 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-134. " 163 UPDATE OXA-376 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4839 UPDATE OXA-504 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 " 4838 UPDATE OXA-503 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 4529 UPDATE CTX-M-200 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4528 UPDATE CTX-M-199 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4527 UPDATE CTX-M-198 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4830 UPDATE OXA-491 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 100 DELETED 35939 " 4525 UPDATE CTX-M-196 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4524 UPDATE CTX-M-195 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4523 UPDATE CTX-M-194 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4522 UPDATE CTX-M-193 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4521 UPDATE CTX-M-192 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4520 UPDATE CTX-M-191 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4420 UPDATE CARB-34 penam; antibiotic inactivation; CARB beta-lactamase; model_sequences "UPDATED fmin with 0 " 909 UPDATE OXA-5 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; OXA-5-like beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-5-like beta-lactamase UPDATED category_aro_cvterm_id with 46512 UPDATED category_aro_accession with 3007723 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-5. " 5298 UPDATE PDC-16 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5299 UPDATE PDC-160 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5296 UPDATE PDC-158 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5297 UPDATE PDC-159 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5294 UPDATE PDC-156 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5295 UPDATE PDC-157 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5292 UPDATE PDC-154 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5293 UPDATE PDC-155 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5290 UPDATE PDC-152 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5291 UPDATE PDC-153 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 3531 UPDATE OXA-466 penam; OXA-184-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-184-like beta-lactamase UPDATED category_aro_cvterm_id with 46491 UPDATED category_aro_accession with 3007702 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-184. " 3530 UPDATE OXA-465 penam; OXA-184-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-184-like beta-lactamase UPDATED category_aro_cvterm_id with 46491 UPDATED category_aro_accession with 3007702 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-184. " 3533 UPDATE OXA-471 penam; antibiotic inactivation; OXA beta-lactamase; OXA-63-like beta-lactamase; oxacillin; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-63-like beta-lactamase UPDATED category_aro_cvterm_id with 46521 UPDATED category_aro_accession with 3007732 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-63. " 3532 UPDATE OXA-470 penam; antibiotic inactivation; OXA beta-lactamase; OXA-63-like beta-lactamase; oxacillin; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-63-like beta-lactamase UPDATED category_aro_cvterm_id with 46521 UPDATED category_aro_accession with 3007732 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-63. " 3535 UPDATE OXA-473 penam; antibiotic inactivation; OXA beta-lactamase; OXA-63-like beta-lactamase; oxacillin; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-63-like beta-lactamase UPDATED category_aro_cvterm_id with 46521 UPDATED category_aro_accession with 3007732 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-63. " 3534 UPDATE OXA-472 penam; antibiotic inactivation; OXA beta-lactamase; OXA-63-like beta-lactamase; oxacillin; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-63-like beta-lactamase UPDATED category_aro_cvterm_id with 46521 UPDATED category_aro_accession with 3007732 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-63. " 3537 UPDATE OXA-475 penam; antibiotic inactivation; OXA beta-lactamase; OXA-63-like beta-lactamase; oxacillin; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-63-like beta-lactamase UPDATED category_aro_cvterm_id with 46521 UPDATED category_aro_accession with 3007732 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-63. " 3536 UPDATE OXA-474 penam; antibiotic inactivation; OXA beta-lactamase; OXA-63-like beta-lactamase; oxacillin; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-63-like beta-lactamase UPDATED category_aro_cvterm_id with 46521 UPDATED category_aro_accession with 3007732 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-63. " 3539 UPDATE OXA-477 penam; antibiotic inactivation; OXA beta-lactamase; OXA-63-like beta-lactamase; oxacillin; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-63-like beta-lactamase UPDATED category_aro_cvterm_id with 46521 UPDATED category_aro_accession with 3007732 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-63. " 3538 UPDATE OXA-476 penam; antibiotic inactivation; OXA beta-lactamase; OXA-63-like beta-lactamase; oxacillin; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-63-like beta-lactamase UPDATED category_aro_cvterm_id with 46521 UPDATED category_aro_accession with 3007732 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-63. " 5056 UPDATE OXA-747 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 25 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5057 UPDATE OXA-748 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 40 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5050 UPDATE OXA-741 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 39 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5051 UPDATE OXA-742 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 33 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5052 UPDATE OXA-743 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 18 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5053 UPDATE OXA-744 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 39 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 674 UPDATE OXA-15 penam; antibiotic inactivation; OXA-2-like beta-lactamase; cephalosporin; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-2-like beta-lactamase UPDATED category_aro_cvterm_id with 46493 UPDATED category_aro_accession with 3007704 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-2. " 675 UPDATE OXA-25 penam; antibiotic inactivation; OXA-24-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-24-like beta-lactamase UPDATED category_aro_cvterm_id with 46500 UPDATED category_aro_accession with 3007711 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-24. " 677 UPDATE OXA-171 antibiotic inactivation; penam; OXA-23-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-23-like beta-lactamase UPDATED category_aro_cvterm_id with 46499 UPDATED category_aro_accession with 3007710 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases, specifically imipenem, derived from OXA-23, first identified in Acinetobacter baumannii. " 1099 UPDATE OXA-48 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; temocillin; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 1978 UPDATE OXA-200 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 1972 UPDATE OXA-149 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5476 UPDATE PDC-347 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5477 UPDATE PDC-348 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5474 UPDATE PDC-344 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5475 UPDATE PDC-345 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5472 UPDATE PDC-342 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5473 UPDATE PDC-343 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5470 UPDATE PDC-340 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5471 UPDATE PDC-341 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5478 UPDATE PDC-349 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5479 UPDATE PDC-35 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5274 UPDATE PDC-137 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5275 UPDATE PDC-138 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 1777 UPDATE OXA-177 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5277 UPDATE PDC-140 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5270 UPDATE PDC-133 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5271 UPDATE PDC-134 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5272 UPDATE PDC-135 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5273 UPDATE PDC-136 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5278 UPDATE PDC-141 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5279 UPDATE PDC-142 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 1151 UPDATE OXA-240 penam; OXA-10-like beta-lactamase; cephalosporin; antibiotic inactivation; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-10-like beta-lactamase UPDATED category_aro_cvterm_id with 46486 UPDATED category_aro_accession with 3007697 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-10. " 5519 UPDATE PDC-39 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5518 UPDATE PDC-389 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 30 UPDATE OXA-226 penam; antibiotic inactivation; OXA-2-like beta-lactamase; cephalosporin; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-2-like beta-lactamase UPDATED category_aro_cvterm_id with 46493 UPDATED category_aro_accession with 3007704 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-2. " 5511 UPDATE PDC-381 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5510 UPDATE PDC-38 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5513 UPDATE PDC-383 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5512 UPDATE PDC-382 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5515 UPDATE PDC-386 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5514 UPDATE PDC-385 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5517 UPDATE PDC-388 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5516 UPDATE PDC-387 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 1551 UPDATE OXA-78 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 59 UPDATE OXA-256 penam; OXA-10-like beta-lactamase; cephalosporin; antibiotic inactivation; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-10-like beta-lactamase UPDATED category_aro_cvterm_id with 46486 UPDATED category_aro_accession with 3007697 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-10. " 55 UPDATE OXA-69 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 537 UPDATE OXA-120 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5605 UPDATE PDC-64 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5604 UPDATE PDC-60 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5607 UPDATE PDC-94 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5606 UPDATE PDC-71 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5601 UPDATE PDC-475 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5600 UPDATE PDC-474 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5603 UPDATE PDC-58 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5136 UPDATE OXA-834 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 100 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5609 UPDATE PDC-96 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5608 UPDATE PDC-95 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5133 UPDATE OXA-831 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 1399 UPDATE OXA-315 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 1398 UPDATE OXA-108 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 1396 UPDATE OXA-11 penam; OXA-10-like beta-lactamase; cephalosporin; antibiotic inactivation; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-10-like beta-lactamase UPDATED category_aro_cvterm_id with 46486 UPDATED category_aro_accession with 3007697 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-10. " 1394 UPDATE OXA-257 antibiotic inactivation; penam; OXA-229-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-229-like beta-lactamase UPDATED category_aro_cvterm_id with 46498 UPDATED category_aro_accession with 3007709 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-229. " 850 UPDATE OXA-26 penam; antibiotic inactivation; OXA-24-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-24-like beta-lactamase UPDATED category_aro_cvterm_id with 46500 UPDATED category_aro_accession with 3007711 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-24. " 4299 UPDATE ADC-234 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 10 " 4298 UPDATE ADC-233 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4295 UPDATE ADC-230 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4294 UPDATE ADC-229 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4297 UPDATE ADC-232 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 853 UPDATE OXA-160 penam; antibiotic inactivation; OXA-24-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-24-like beta-lactamase UPDATED category_aro_cvterm_id with 46500 UPDATED category_aro_accession with 3007711 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-24. " 4291 UPDATE ADC-226 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4290 UPDATE ADC-225 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4293 UPDATE ADC-228 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4292 UPDATE ADC-227 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4695 UPDATE IMP-69 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 0 " 4749 UPDATE LHK-4 carbapenem; antibiotic inactivation; cephalosporin; LHK beta-lactamase; model_sequences "UPDATED fmin with 0 " 4748 UPDATE LHK-3 carbapenem; antibiotic inactivation; cephalosporin; LHK beta-lactamase; model_sequences "UPDATED fmin with 0 " 4743 UPDATE LEN-27 penam; LEN beta-lactamase; antibiotic inactivation; penem; model_sequences "UPDATED fmin with 100 " 4741 UPDATE KPC-82 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; model_sequences "UPDATED fmin with 0 " 4740 UPDATE KPC-81 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; model_sequences "UPDATED fmin with 0 " 4747 UPDATE LHK-2 carbapenem; antibiotic inactivation; cephalosporin; LHK beta-lactamase; model_sequences "UPDATED fmin with 0 " 4746 UPDATE LHK-1 carbapenem; antibiotic inactivation; cephalosporin; LHK beta-lactamase; model_sequences "UPDATED fmin with 0 " 4745 UPDATE LEN-31 penam; LEN beta-lactamase; antibiotic inactivation; penem; model_sequences "UPDATED fmin with 100 " 4744 UPDATE LEN-28 penam; LEN beta-lactamase; antibiotic inactivation; penem; model_sequences "UPDATED fmin with 100 " 4608 UPDATE FRI-10 FRI beta-lactamase; penam; antibiotic inactivation; model_sequences "UPDATED fmin with 0 " 4609 UPDATE GES-25 carbapenem; penam; cephalosporin; antibiotic inactivation; GES beta-lactamase; model_sequences "UPDATED fmin with 0 " 4606 UPDATE FOX-16 antibiotic inactivation; cephamycin; cephalosporin; FOX beta-lactamase; model_sequences "UPDATED fmin with 0 " 226 UPDATE OXA-113 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4604 UPDATE FOX-14 antibiotic inactivation; cephamycin; cephalosporin; FOX beta-lactamase; model_sequences "UPDATED fmin with 0 " 4605 UPDATE FOX-15 antibiotic inactivation; cephamycin; cephalosporin; FOX beta-lactamase; model_sequences "UPDATED fmin with 0 " 4602 UPDATE FOX-12 antibiotic inactivation; cephamycin; cephalosporin; FOX beta-lactamase; model_sequences "UPDATED fmin with 0 " 4603 UPDATE FOX-13 antibiotic inactivation; cephamycin; cephalosporin; FOX beta-lactamase; model_sequences "UPDATED fmin with 0 " 4600 UPDATE EVM-1 carbapenem; antibiotic inactivation; EVM beta-lactamase; model_sequences "UPDATED fmin with 0 " 4601 UPDATE FIA-1 carbapenem; antibiotic inactivation; FIA beta-lactamase; model_sequences "UPDATED fmin with 100 " 5602 UPDATE PDC-476 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 4518 UPDATE CTX-M-189 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4519 UPDATE CTX-M-190 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 100 " 4512 UPDATE CTX-M-183 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4513 UPDATE CTX-M-184 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4510 UPDATE CTX-M-181 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4511 UPDATE CTX-M-182 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4516 UPDATE CTX-M-187 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4517 UPDATE CTX-M-188 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4514 UPDATE CTX-M-185 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4515 UPDATE CTX-M-186 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 1359 UPDATE OXA-233 penam; OXA-10-like beta-lactamase; cephalosporin; antibiotic inactivation; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-10-like beta-lactamase UPDATED category_aro_cvterm_id with 46486 UPDATED category_aro_accession with 3007697 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-10. " 5289 UPDATE PDC-151 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5288 UPDATE PDC-150 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5281 UPDATE PDC-144 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5280 UPDATE PDC-143 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5283 UPDATE PDC-146 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5282 UPDATE PDC-145 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5285 UPDATE PDC-148 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5284 UPDATE PDC-147 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5287 UPDATE PDC-15 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5286 UPDATE PDC-149 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5049 UPDATE OXA-740 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 40 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5048 UPDATE OXA-739 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5047 UPDATE OXA-738 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 49 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5046 UPDATE OXA-736 penam; OXA-10-like beta-lactamase; cephalosporin; antibiotic inactivation; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-10-like beta-lactamase UPDATED category_aro_cvterm_id with 46486 UPDATED category_aro_accession with 3007697 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-10. " 5045 UPDATE OXA-735 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5044 UPDATE OXA-734 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5043 UPDATE OXA-733 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5042 UPDATE OXA-732 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 100 DELETED 35939 " 5041 UPDATE OXA-731 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 5040 UPDATE OXA-730 penam; antibiotic inactivation; OXA-679-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-679-like beta-lactamase UPDATED category_aro_cvterm_id with 46522 UPDATED category_aro_accession with 3007733 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-679. " 1807 UPDATE OXA-70 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 1806 UPDATE OXA-14 penam; OXA-10-like beta-lactamase; cephalosporin; antibiotic inactivation; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-10-like beta-lactamase UPDATED category_aro_cvterm_id with 46486 UPDATED category_aro_accession with 3007697 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-10. " 1804 UPDATE OXA-107 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 1802 UPDATE OXA-168 antibiotic inactivation; penam; OXA-23-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-23-like beta-lactamase UPDATED category_aro_cvterm_id with 46499 UPDATED category_aro_accession with 3007710 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases, specifically imipenem, derived from OXA-23, first identified in Acinetobacter baumannii. " 4996 UPDATE OXA-684 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 29 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4997 UPDATE OXA-685 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 39 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4994 UPDATE OXA-682 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 13 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4995 UPDATE OXA-683 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 13 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4992 UPDATE OXA-679 penam; antibiotic inactivation; OXA-679-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-679-like beta-lactamase UPDATED category_aro_cvterm_id with 46522 UPDATED category_aro_accession with 3007733 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-679. " 4993 UPDATE OXA-680 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 11 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4990 UPDATE OXA-677 penam; OXA-10-like beta-lactamase; cephalosporin; antibiotic inactivation; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-10-like beta-lactamase UPDATED category_aro_cvterm_id with 46486 UPDATED category_aro_accession with 3007697 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-10. " 4991 UPDATE OXA-678 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 4998 UPDATE OXA-686 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 13 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4999 UPDATE OXA-687 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 13 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 813 UPDATE OXA-216 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 816 UPDATE OXA-3 penam; antibiotic inactivation; OXA-2-like beta-lactamase; cephalosporin; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-2-like beta-lactamase UPDATED category_aro_cvterm_id with 46493 UPDATED category_aro_accession with 3007704 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-2. " 5461 UPDATE PDC-331 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5460 UPDATE PDC-330 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5463 UPDATE PDC-333 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5462 UPDATE PDC-332 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5465 UPDATE PDC-335 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5464 UPDATE PDC-334 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5467 UPDATE PDC-338 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5466 UPDATE PDC-336 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5469 UPDATE PDC-34 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5468 UPDATE PDC-339 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5267 UPDATE PDC-130 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5266 UPDATE PDC-13 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5265 UPDATE PDC-129 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5264 UPDATE PDC-128 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5263 UPDATE PDC-127 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5262 UPDATE PDC-126 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 1706 UPDATE OXA-142 penam; OXA-10-like beta-lactamase; cephalosporin; antibiotic inactivation; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-10-like beta-lactamase UPDATED category_aro_cvterm_id with 46486 UPDATED category_aro_accession with 3007697 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-10. " 5260 UPDATE PDC-124 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 4572 UPDATE CTX-M-244 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 5269 UPDATE PDC-132 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5268 UPDATE PDC-131 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 4573 UPDATE CTX-M-73 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 100 " 4574 UPDATE CTX-M-97 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4575 UPDATE CVI-1 carbapenem; antibiotic inactivation; CVI beta-lactamase; model_sequences "UPDATED fmin with 72 " 1128 UPDATE OXA-23 antibiotic inactivation; penam; OXA-23-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-23-like beta-lactamase UPDATED category_aro_cvterm_id with 46499 UPDATED category_aro_accession with 3007710 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases, specifically imipenem, derived from OXA-23, first identified in Acinetobacter baumannii. " 1169 UPDATE OXA-360 penam; antibiotic inactivation; OXA-134-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-134-like beta-lactamase UPDATED category_aro_cvterm_id with 46489 UPDATED category_aro_accession with 3007700 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-134. " 1122 UPDATE OXA-180 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 1126 UPDATE OXA-184 penam; OXA-184-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-184-like beta-lactamase UPDATED category_aro_cvterm_id with 46491 UPDATED category_aro_accession with 3007702 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-184. " 521 UPDATE OXA-386 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 523 UPDATE OXA-75 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 1016 UPDATE OXA-255 OXA-143-like beta-lactamase; antibiotic inactivation; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-143-like beta-lactamase UPDATED category_aro_cvterm_id with 46490 UPDATED category_aro_accession with 3007701 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-143. " 4909 UPDATE OXA-583 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 4198 UPDATE ADC-127 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4199 UPDATE ADC-128 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4196 UPDATE ADC-123 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4197 UPDATE ADC-125 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4194 UPDATE ADC-121 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4195 UPDATE ADC-122 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 1238 UPDATE OXA-397 penam; antibiotic inactivation; OXA-58-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-58-like beta-lactamase UPDATED category_aro_cvterm_id with 46517 UPDATED category_aro_accession with 3007728 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-58. " 4193 UPDATE ADC-120 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4190 UPDATE ADC-116 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4191 UPDATE ADC-117 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 5670 UPDATE TER-1 carbapenem; TER beta-lactamase; cephalosporin; antibiotic inactivation; model_sequences "UPDATED fmin with 100 " 5671 UPDATE TER-2 carbapenem; TER beta-lactamase; cephalosporin; antibiotic inactivation; model_sequences "UPDATED fmin with 100 " 5672 UPDATE TTU-1 carbapenem; antibiotic inactivation; TTU beta-lactamase; model_sequences "UPDATED fmin with 100 " 5673 UPDATE VEB-10 antibiotic inactivation; monobactam; cephalosporin; VEB beta-lactamase; model_sequences "UPDATED fmin with 0 " 4358 UPDATE ALG11-1 carbapenem; antibiotic inactivation; ALG11 beta-lactamase; model_sequences "UPDATED fmin with 0 " 5675 UPDATE VEB-12 antibiotic inactivation; monobactam; cephalosporin; VEB beta-lactamase; model_sequences "UPDATED fmin with 0 " 5676 UPDATE VEB-13 antibiotic inactivation; monobactam; cephalosporin; VEB beta-lactamase; model_sequences "UPDATED fmin with 0 " 5677 UPDATE VEB-14 antibiotic inactivation; monobactam; cephalosporin; VEB beta-lactamase; model_sequences "UPDATED fmin with 0 " 5678 UPDATE VEB-15 antibiotic inactivation; monobactam; cephalosporin; VEB beta-lactamase; model_sequences "UPDATED fmin with 0 " 4355 UPDATE ADC-99 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4356 UPDATE AFM-1 carbapenem; antibiotic inactivation; AFM beta-lactamase; model_sequences "UPDATED fmin with 0 " 4357 UPDATE AFM-2 carbapenem; antibiotic inactivation; AFM beta-lactamase; model_sequences "UPDATED fmin with 0 " 4350 UPDATE ADC-94 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4351 UPDATE ADC-95 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4352 UPDATE ADC-96 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4353 UPDATE ADC-97 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4677 UPDATE IMI-6 carbapenem; antibiotic inactivation; IMI beta-lactamase; model_sequences "UPDATED fmin with 100 " 4676 UPDATE IMI-5 carbapenem; antibiotic inactivation; IMI beta-lactamase; model_sequences "UPDATED fmin with 100 " 4675 UPDATE IMI-21 carbapenem; antibiotic inactivation; IMI beta-lactamase; model_sequences "UPDATED fmin with 0 " 430 UPDATE OXA-87 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4674 UPDATE IMI-20 carbapenem; antibiotic inactivation; IMI beta-lactamase; model_sequences "UPDATED fmin with 0 " 4905 UPDATE OXA-579 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 3800 UPDATE OXA-837 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 " 4904 UPDATE OXA-578 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 4671 UPDATE IMI-17 carbapenem; antibiotic inactivation; IMI beta-lactamase; model_sequences "UPDATED fmin with 0 " 4670 UPDATE IMI-16 carbapenem; antibiotic inactivation; IMI beta-lactamase; model_sequences "UPDATED fmin with 0 " 5708 UPDATE VIM-59 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; model_sequences "UPDATED fmin with 93 " 5709 UPDATE VIM-60 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; model_sequences "UPDATED fmin with 0 " 5704 UPDATE VIM-55 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; model_sequences "UPDATED fmin with 0 " 5705 UPDATE VIM-56 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; model_sequences "UPDATED fmin with 0 " 5706 UPDATE VIM-57 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; model_sequences "UPDATED fmin with 0 " 5707 UPDATE VIM-58 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; model_sequences "UPDATED fmin with 0 " 5700 UPDATE VIM-51 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; model_sequences "UPDATED fmin with 0 " 5701 UPDATE VIM-52 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; model_sequences "UPDATED fmin with 0 " 5702 UPDATE VIM-53 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; model_sequences "UPDATED fmin with 0 " 5703 UPDATE VIM-54 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; model_sequences "UPDATED fmin with 0 " 4174 UPDATE ACT-84 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 4175 UPDATE ACT-87 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 100 " 4176 UPDATE ADC-100 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4177 UPDATE ADC-101 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4170 UPDATE ACT-80 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 4171 UPDATE ACT-81 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 4172 UPDATE ACT-82 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 4173 UPDATE ACT-83 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 4178 UPDATE ADC-102 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4179 UPDATE ADC-103 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 5065 UPDATE OXA-756 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 40 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4296 UPDATE ADC-231 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 5064 UPDATE OXA-755 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 13 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4619 UPDATE GES-36 carbapenem; penam; cephalosporin; antibiotic inactivation; GES beta-lactamase; model_sequences "UPDATED fmin with 0 " 4618 UPDATE GES-35 carbapenem; penam; cephalosporin; antibiotic inactivation; GES beta-lactamase; model_sequences "UPDATED fmin with 0 " 239 UPDATE OXA-83 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4611 UPDATE GES-28 carbapenem; penam; cephalosporin; antibiotic inactivation; GES beta-lactamase; model_sequences "UPDATED fmin with 0 " 235 UPDATE OXA-181 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 4613 UPDATE GES-30 carbapenem; penam; cephalosporin; antibiotic inactivation; GES beta-lactamase; model_sequences "UPDATED fmin with 0 " 4612 UPDATE GES-29 carbapenem; penam; cephalosporin; antibiotic inactivation; GES beta-lactamase; model_sequences "UPDATED fmin with 0 " 230 UPDATE OXA-422 antibiotic inactivation; penam; OXA-23-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-23-like beta-lactamase UPDATED category_aro_cvterm_id with 46499 UPDATED category_aro_accession with 3007710 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases, specifically imipenem, derived from OXA-23, first identified in Acinetobacter baumannii. " 231 UPDATE OXA-178 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4617 UPDATE GES-34 carbapenem; penam; cephalosporin; antibiotic inactivation; GES beta-lactamase; model_sequences "UPDATED fmin with 0 " 4616 UPDATE GES-33 carbapenem; penam; cephalosporin; antibiotic inactivation; GES beta-lactamase; model_sequences "UPDATED fmin with 0 " 146 UPDATE OXA-98 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 147 UPDATE OXA-27 antibiotic inactivation; penam; OXA-23-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-23-like beta-lactamase UPDATED category_aro_cvterm_id with 46499 UPDATED category_aro_accession with 3007710 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases, specifically imipenem, derived from OXA-23, first identified in Acinetobacter baumannii. " 145 UPDATE OXA-229 antibiotic inactivation; penam; OXA-229-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-229-like beta-lactamase UPDATED category_aro_cvterm_id with 46498 UPDATED category_aro_accession with 3007709 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-229. " 5069 UPDATE OXA-760 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 29 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 1052 UPDATE OXA-206 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5068 UPDATE OXA-759 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 40 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4505 UPDATE CTX-M-176 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4504 UPDATE CTX-M-175 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4507 UPDATE CTX-M-178 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4506 UPDATE CTX-M-177 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4501 UPDATE CTX-M-172 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4500 UPDATE CTX-M-171 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4503 UPDATE CTX-M-174 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4502 UPDATE CTX-M-173 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4509 UPDATE CTX-M-180 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4508 UPDATE CTX-M-179 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 2088 UPDATE Mycolicibacterium smegmatis 16S rRNA (rrsB) mutation conferring resistance to streptomycin antibiotic target alteration; streptomycin; aminoglycoside antibiotic; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; model_sequences "UPDATED fmin with 5027947 " 2080 UPDATE Escherichia coli 16S rRNA (rrsH) mutation conferring resistance to spectinomycin antibiotic target alteration; aminoglycoside antibiotic; spectinomycin; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; model_sequences "UPDATED fmin with 223770 " 2086 UPDATE Escherichia coli 16S rRNA (rrnB) mutation conferring resistance to tetracycline tetracycline antibiotic; antibiotic target alteration; 16S rRNA with mutation conferring resistance to tetracycline derivatives; tetracycline; model_sequences "UPDATED fmin with 4166658 " 2084 UPDATE Mycobacteroides abscessus 16S rRNA mutation conferring resistance to amikacin antibiotic target alteration; amikacin; aminoglycoside antibiotic; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; model_sequences "UPDATED fmin with 1462397 " 2085 UPDATE Escherichia coli 16S rRNA (rrnB) mutation conferring resistance to spectinomycin antibiotic target alteration; aminoglycoside antibiotic; spectinomycin; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; model_sequences "UPDATED fmin with 4166658 " 5451 UPDATE PDC-320 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5455 UPDATE PDC-326 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5078 UPDATE OXA-769 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 18 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5079 UPDATE OXA-770 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 33 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5072 UPDATE OXA-763 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 13 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5073 UPDATE OXA-764 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 47 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5070 UPDATE OXA-761 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 14 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5071 UPDATE OXA-762 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 24 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5076 UPDATE OXA-767 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 36 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5077 UPDATE OXA-768 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 12 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5074 UPDATE OXA-765 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 13 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5075 UPDATE OXA-766 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 40 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 1833 UPDATE OXA-374 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 1836 UPDATE OXA-201 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4981 UPDATE OXA-661 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; OXA-266-like beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-266-like beta-lactamase UPDATED category_aro_cvterm_id with 46501 UPDATED category_aro_accession with 3007712 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-266. " 4980 UPDATE OXA-660 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 4983 UPDATE OXA-666 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 100 DELETED 35939 " 2157 UPDATE Escherichia coli 16S rRNA (rrsB) mutation conferring resistance to gentamicin C antibiotic target alteration; aminoglycoside antibiotic; gentamicin C; gentamicin; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; model_sequences "UPDATED fmin with 4166658 " 4985 UPDATE OXA-669 antibiotic inactivation; penam; OXA-274-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 100 DELETED 35930 UPDATED category_aro_name with OXA-274-like beta-lactamase UPDATED category_aro_cvterm_id with 46502 UPDATED category_aro_accession with 3007713 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-274. " 4984 UPDATE OXA-667 antibiotic inactivation; penam; OXA-274-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 100 DELETED 35930 UPDATED category_aro_name with OXA-274-like beta-lactamase UPDATED category_aro_cvterm_id with 46502 UPDATED category_aro_accession with 3007713 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-274. " 4987 UPDATE OXA-674 penam; antibiotic inactivation; OXA-286-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 100 DELETED 35930 UPDATED category_aro_name with OXA-286-like beta-lactamase UPDATED category_aro_cvterm_id with 46503 UPDATED category_aro_accession with 3007714 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-286. " 4986 UPDATE OXA-670 penam; antibiotic inactivation; OXA-286-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 100 DELETED 35930 UPDATED category_aro_name with OXA-286-like beta-lactamase UPDATED category_aro_cvterm_id with 46503 UPDATED category_aro_accession with 3007714 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-286. " 4989 UPDATE OXA-676 penam; OXA-10-like beta-lactamase; cephalosporin; antibiotic inactivation; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-10-like beta-lactamase UPDATED category_aro_cvterm_id with 46486 UPDATED category_aro_accession with 3007697 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-10. " 4988 UPDATE OXA-675 penam; antibiotic inactivation; OXA-1-like beta-lactamase; cephalosporin; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-1-like beta-lactamase UPDATED category_aro_cvterm_id with 46485 UPDATED category_aro_accession with 3007696 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-1. " 931 UPDATE OXA-316 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 937 UPDATE OXA-242 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 935 UPDATE OXA-314 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5380 UPDATE PDC-242 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5381 UPDATE PDC-243 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5382 UPDATE PDC-244 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5383 UPDATE PDC-245 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5384 UPDATE PDC-246 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5385 UPDATE PDC-247 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5386 UPDATE PDC-248 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5387 UPDATE PDC-249 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5388 UPDATE PDC-25 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5389 UPDATE PDC-250 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 1955 UPDATE OXA-29 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 " 4391 UPDATE BlaB-3 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences "UPDATED fmin with 0 " 1952 UPDATE OXA-1 penam; antibiotic inactivation; OXA-1-like beta-lactamase; cephalosporin; cefalotin; oxacillin; ampicillin; amoxicillin; piperacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-1-like beta-lactamase UPDATED category_aro_cvterm_id with 46485 UPDATED category_aro_accession with 3007696 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-1. " 4392 UPDATE BlaB-30 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences "UPDATED fmin with 100 " 4925 UPDATE OXA-599 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 5498 UPDATE PDC-368 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5499 UPDATE PDC-369 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5494 UPDATE PDC-364 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5495 UPDATE PDC-365 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5496 UPDATE PDC-366 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5497 UPDATE PDC-367 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5490 UPDATE PDC-360 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5491 UPDATE PDC-361 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5492 UPDATE PDC-362 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5493 UPDATE PDC-363 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5252 UPDATE PDC-114 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5253 UPDATE PDC-115 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5250 UPDATE PDC-112 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5251 UPDATE PDC-113 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5256 UPDATE PDC-120 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5257 UPDATE PDC-121 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5254 UPDATE PDC-116 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5255 UPDATE PDC-12 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5258 UPDATE PDC-122 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5259 UPDATE PDC-123 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 4394 UPDATE BlaB-32 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences "UPDATED fmin with 100 " 1132 UPDATE OXA-88 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4395 UPDATE BlaB-33 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences "UPDATED fmin with 100 " 4396 UPDATE BlaB-34 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences "UPDATED fmin with 100 " 4973 UPDATE OXA-652 antibiotic inactivation; penam; OXA-211-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 100 DELETED 35930 UPDATED category_aro_name with OXA-211-like beta-lactamase UPDATED category_aro_cvterm_id with 46494 UPDATED category_aro_accession with 3007705 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-211. " 1003 UPDATE OXA-18 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 " 623 UPDATE OXA-68 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4188 UPDATE ADC-114 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 30 " 620 UPDATE OXA-320 penam; antibiotic inactivation; OXA-1-like beta-lactamase; cephalosporin; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-1-like beta-lactamase UPDATED category_aro_cvterm_id with 46485 UPDATED category_aro_accession with 3007696 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-1. " 1221 UPDATE OXA-231 OXA-143-like beta-lactamase; antibiotic inactivation; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-143-like beta-lactamase UPDATED category_aro_cvterm_id with 46490 UPDATED category_aro_accession with 3007701 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-143. " 4181 UPDATE ADC-105 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4180 UPDATE ADC-104 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4183 UPDATE ADC-107 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4182 UPDATE ADC-106 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4185 UPDATE ADC-110 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4184 UPDATE ADC-109 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4187 UPDATE ADC-113 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4186 UPDATE ADC-112 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 5663 UPDATE SPU-1 carbapenem; antibiotic inactivation; SPU beta-lactamase; model_sequences "UPDATED fmin with 0 " 5662 UPDATE SPS-1 SPS beta-lactamase; carbapenem; antibiotic inactivation; model_sequences "UPDATED fmin with 100 " 5661 UPDATE SPR-1 carbapenem; SPR beta-lactamase; antibiotic inactivation; model_sequences "UPDATED fmin with 100 " 5660 UPDATE SPN79-1 carbapenem; antibiotic inactivation; SPN79 beta-lactamase; model_sequences "UPDATED fmin with 0 " 5666 UPDATE STA-1 STA beta-lactamase; carbapenem; antibiotic inactivation; model_sequences "UPDATED fmin with 100 " 5665 UPDATE SST-1 antibiotic inactivation; cephalosporin; SST beta-lactamase; model_sequences "UPDATED fmin with 100 " 5664 UPDATE SRT-3 antibiotic inactivation; cephalosporin; SRT beta-lactamase; model_sequences "UPDATED fmin with 0 " 4347 UPDATE ADC-91 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4346 UPDATE ADC-90 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4345 UPDATE ADC-89 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4344 UPDATE ADC-88 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4343 UPDATE ADC-87 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4342 UPDATE ADC-86 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4341 UPDATE ADC-85 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4340 UPDATE ADC-84 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 5719 UPDATE VIM-70 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; model_sequences "UPDATED fmin with 0 " 5718 UPDATE VIM-69 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; model_sequences "UPDATED fmin with 100 " 5717 UPDATE VIM-68 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; model_sequences "UPDATED fmin with 0 " 18 UPDATE OXA-212 antibiotic inactivation; penam; OXA-211-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-211-like beta-lactamase UPDATED category_aro_cvterm_id with 46494 UPDATED category_aro_accession with 3007705 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-211. " 5715 UPDATE VIM-66 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; model_sequences "UPDATED fmin with 0 " 5714 UPDATE VIM-65 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; model_sequences "UPDATED fmin with 0 " 5713 UPDATE VIM-64 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; model_sequences "UPDATED fmin with 0 " 5712 UPDATE VIM-63 penam; carbapenem; imipenem; penem; faropenem; cephalosporin; cefotaxime; ceftazidime; cefepime; cephamycin; antibiotic inactivation; ampicillin; VIM beta-lactamase; ertapenem; meropenem; model_sequences "UPDATED fmin with 0 " 5711 UPDATE VIM-62 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; model_sequences "UPDATED fmin with 0 " 5710 UPDATE VIM-61 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; model_sequences "UPDATED fmin with 0 " 4761 UPDATE MAL-2 carbapenem; antibiotic inactivation; MAL beta-lactamase; model_sequences "UPDATED fmin with 2 " 4760 UPDATE MAL-1 carbapenem; antibiotic inactivation; MAL beta-lactamase; model_sequences "UPDATED fmin with 11 " 4167 UPDATE ACT-77 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 4166 UPDATE ACT-76 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 100 " 4165 UPDATE ACT-75 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 100 " 4164 UPDATE ACT-74 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 100 " 4163 UPDATE ACT-73 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 4162 UPDATE ACT-72 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 4161 UPDATE ACT-70 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 4160 UPDATE ACT-69 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 4169 UPDATE ACT-79 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 4168 UPDATE ACT-78 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 3498 UPDATE OXA-414 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 3499 UPDATE OXA-416 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 3496 UPDATE OXA-412 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 3497 UPDATE OXA-413 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 3494 UPDATE OXA-409 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 3495 UPDATE OXA-411 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 3492 UPDATE OXA-407 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 3493 UPDATE OXA-408 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 3490 UPDATE OXA-405 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 3491 UPDATE OXA-406 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4570 UPDATE CTX-M-241 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4571 UPDATE CTX-M-242 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 2097 UPDATE Escherichia coli 16S rRNA (rrsB) mutation conferring resistance to paromomycin antibiotic target alteration; aminoglycoside antibiotic; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; paromomycin; model_sequences "UPDATED fmin with 4166658 " 2096 UPDATE Escherichia coli 16S rRNA (rrsC) mutation conferring resistance to kasugamicin antibiotic target alteration; aminoglycoside antibiotic; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; kasugamycin; model_sequences "UPDATED fmin with 3941807 " 2091 UPDATE Mycobacteroides chelonae 16S rRNA mutation conferring resistance to gentamicin C antibiotic target alteration; aminoglycoside antibiotic; gentamicin C; gentamicin; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; model_sequences "UPDATED fmin with 0 " 2090 UPDATE Mycobacteroides abscessus 16S rRNA mutation conferring resistance to kanamycin kanamycin A; antibiotic target alteration; aminoglycoside antibiotic; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; model_sequences "UPDATED fmin with 1462397 " 4576 UPDATE DHA-23 antibiotic inactivation; cephalosporin; cephamycin; DHA beta-lactamase; model_sequences "UPDATED fmin with 0 " 4577 UPDATE DHA-24 antibiotic inactivation; cephalosporin; cephamycin; DHA beta-lactamase; model_sequences "UPDATED fmin with 0 " 4578 UPDATE DHA-25 antibiotic inactivation; cephalosporin; cephamycin; DHA beta-lactamase; model_sequences "UPDATED fmin with 0 " 4579 UPDATE DHA-26 antibiotic inactivation; cephalosporin; cephamycin; DHA beta-lactamase; model_sequences "UPDATED fmin with 0 " 2099 UPDATE Mycolicibacterium smegmatis 16S rRNA (rrsB) mutation conferring resistance to kanamycin A kanamycin A; antibiotic target alteration; aminoglycoside antibiotic; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; model_sequences "UPDATED fmin with 5027947 " 2098 UPDATE Mycolicibacterium smegmatis 16S rRNA (rrsB) mutation conferring resistance to viomycin peptide antibiotic; antibiotic target alteration; 16s rRNA with mutation conferring resistance to peptide antibiotics; viomycin; model_sequences "UPDATED fmin with 5027947 " 4888 UPDATE OXA-559 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4889 UPDATE OXA-560 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5067 UPDATE OXA-758 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 43 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5066 UPDATE OXA-757 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 40 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5061 UPDATE OXA-752 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 13 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5060 UPDATE OXA-751 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 13 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5063 UPDATE OXA-754 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 29 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5062 UPDATE OXA-753 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 39 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4880 UPDATE OXA-551 OXA-548-like beta-lactamase; penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-548-like beta-lactamase UPDATED category_aro_cvterm_id with 46515 UPDATED category_aro_accession with 3007726 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-548. " 4881 UPDATE OXA-552 OXA-548-like beta-lactamase; penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-548-like beta-lactamase UPDATED category_aro_cvterm_id with 46515 UPDATED category_aro_accession with 3007726 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-548. " 4882 UPDATE OXA-553 OXA-548-like beta-lactamase; penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-548-like beta-lactamase UPDATED category_aro_cvterm_id with 46515 UPDATED category_aro_accession with 3007726 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-548. " 4883 UPDATE OXA-554 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4884 UPDATE OXA-555 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4885 UPDATE OXA-556 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4886 UPDATE OXA-557 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4887 UPDATE OXA-558 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4408 UPDATE CAR-1 carbapenem; antibiotic inactivation; CAR beta-lactamase; model_sequences "UPDATED fmin with 100 " 4409 UPDATE CARB-11 penam; antibiotic inactivation; CARB beta-lactamase; model_sequences "UPDATED fmin with 0 " 4404 UPDATE BlaB-8 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences "UPDATED fmin with 0 " 4405 UPDATE BlaB-9 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences "UPDATED fmin with 0 " 4406 UPDATE BSU-1 carbapenem; antibiotic inactivation; BSU beta-lactamase; model_sequences "UPDATED fmin with 100 " 4407 UPDATE BUT-2 BUT beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 4400 UPDATE BlaB-39 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences "UPDATED fmin with 100 " 4401 UPDATE BlaB-5 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences "UPDATED fmin with 0 " 4402 UPDATE BlaB-6 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences "UPDATED fmin with 100 " 4403 UPDATE BlaB-7 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences "UPDATED fmin with 0 " 2146 UPDATE Escherichia coli 16S rRNA (rrnB) mutation conferring resistance to streptomycin antibiotic target alteration; streptomycin; aminoglycoside antibiotic; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; model_sequences "UPDATED fmin with 4166658 " 2145 UPDATE Escherichia coli 16S rRNA (rrsB) mutation conferring resistance to tetracycline tetracycline antibiotic; antibiotic target alteration; 16S rRNA with mutation conferring resistance to tetracycline derivatives; tetracycline; model_sequences "UPDATED fmin with 4166658 " 4978 UPDATE OXA-658 penam; OXA-184-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-184-like beta-lactamase UPDATED category_aro_cvterm_id with 46491 UPDATED category_aro_accession with 3007702 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-184. " 4979 UPDATE OXA-659 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 2141 UPDATE Mycolicibacterium smegmatis 16S rRNA (rrsB) mutation conferring resistance to neomycin antibiotic target alteration; aminoglycoside antibiotic; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; neomycin; model_sequences "UPDATED fmin with 5027947 " 2140 UPDATE Escherichia coli 16S rRNA (rrsB) mutation conferring resistance to streptomycin antibiotic target alteration; streptomycin; aminoglycoside antibiotic; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; model_sequences "UPDATED fmin with 4166658 " 4974 UPDATE OXA-654 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4975 UPDATE OXA-655 penam; OXA-10-like beta-lactamase; cephalosporin; antibiotic inactivation; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 100 DELETED 35939 UPDATED category_aro_name with OXA-10-like beta-lactamase UPDATED category_aro_cvterm_id with 46486 UPDATED category_aro_accession with 3007697 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-10. " 4976 UPDATE OXA-656 penam; OXA-10-like beta-lactamase; cephalosporin; antibiotic inactivation; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 100 DELETED 35939 UPDATED category_aro_name with OXA-10-like beta-lactamase UPDATED category_aro_cvterm_id with 46486 UPDATED category_aro_accession with 3007697 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-10. " 4977 UPDATE OXA-657 antibiotic inactivation; penam; OXA-23-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-23-like beta-lactamase UPDATED category_aro_cvterm_id with 46499 UPDATED category_aro_accession with 3007710 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases, specifically imipenem, derived from OXA-23, first identified in Acinetobacter baumannii. " 4970 UPDATE OXA-645 antibiotic inactivation; penam; OXA-211-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-211-like beta-lactamase UPDATED category_aro_cvterm_id with 46494 UPDATED category_aro_accession with 3007705 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-211. " 4971 UPDATE OXA-650 antibiotic inactivation; penam; OXA-211-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-211-like beta-lactamase UPDATED category_aro_cvterm_id with 46494 UPDATED category_aro_accession with 3007705 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-211. " 4972 UPDATE OXA-651 antibiotic inactivation; penam; OXA-211-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 100 DELETED 35930 UPDATED category_aro_name with OXA-211-like beta-lactamase UPDATED category_aro_cvterm_id with 46494 UPDATED category_aro_accession with 3007705 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-211. " 927 UPDATE OXA-381 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5393 UPDATE PDC-254 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5392 UPDATE PDC-253 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5391 UPDATE PDC-252 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5390 UPDATE PDC-251 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5397 UPDATE PDC-260 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5396 UPDATE PDC-26 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5395 UPDATE PDC-259 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5394 UPDATE PDC-256 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5399 UPDATE PDC-262 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5398 UPDATE PDC-261 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 1928 UPDATE OXA-50 penam; antibiotic inactivation; OXA-50-like beta-lactamase; cephalosporin; cefalotin; oxacillin; ampicillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-50-like beta-lactamase UPDATED category_aro_cvterm_id with 46513 UPDATED category_aro_accession with 3007724 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-50. " 3474 UPDATE OXA-340 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 3475 UPDATE OXA-341 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 3476 UPDATE OXA-342 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 3477 UPDATE OXA-343 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 3470 UPDATE OXA-308 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 " 3471 UPDATE OXA-336 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 3472 UPDATE OXA-337 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 3473 UPDATE OXA-339 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 3478 UPDATE OXA-344 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 3479 UPDATE OXA-345 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5489 UPDATE PDC-36 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5488 UPDATE PDC-359 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5487 UPDATE PDC-358 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5486 UPDATE PDC-357 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5485 UPDATE PDC-356 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5484 UPDATE PDC-355 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5483 UPDATE PDC-354 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5482 UPDATE PDC-353 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5481 UPDATE PDC-351 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5480 UPDATE PDC-350 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5249 UPDATE PDC-111 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5248 UPDATE PDC-110 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 1728 UPDATE OXA-42 penam; OXA-42-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-42-like beta-lactamase UPDATED category_aro_cvterm_id with 46507 UPDATED category_aro_accession with 3007718 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-42. " 5245 UPDATE PDC-107 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5244 UPDATE PDC-106 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5247 UPDATE PDC-109 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5246 UPDATE PDC-108 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5241 UPDATE PDC-101 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5240 UPDATE PDC-100 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5243 UPDATE PDC-103 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5242 UPDATE PDC-102 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5627 UPDATE PLA-3 carbapenem; antibiotic inactivation; cephalosporin; PLA beta-lactamase; model_sequences "UPDATED fmin with 100 " 5626 UPDATE PLA-2a carbapenem; antibiotic inactivation; cephalosporin; PLA beta-lactamase; model_sequences "UPDATED fmin with 100 " 5625 UPDATE PLA-1 carbapenem; antibiotic inactivation; cephalosporin; PLA beta-lactamase; model_sequences "UPDATED fmin with 100 " 4380 UPDATE BlaB-19 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences "UPDATED fmin with 100 " 5623 UPDATE PFM-2 carbapenem; antibiotic inactivation; PFM beta-lactamase; model_sequences "UPDATED fmin with 0 " 5622 UPDATE PFM-1 carbapenem; antibiotic inactivation; PFM beta-lactamase; model_sequences "UPDATED fmin with 0 " 61 UPDATE OXA-330 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 5621 UPDATE PER-9 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; PER beta-lactamase; monobactam; model_sequences "UPDATED fmin with 0 " 67 UPDATE OXA-391 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5620 UPDATE PER-8 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; PER beta-lactamase; monobactam; model_sequences "UPDATED fmin with 100 " 1587 UPDATE OXA-10 penam; OXA-10-like beta-lactamase; cephalosporin; antibiotic inactivation; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-10-like beta-lactamase UPDATED category_aro_cvterm_id with 46486 UPDATED category_aro_accession with 3007697 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-10. " 1032 UPDATE OXA-365 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 1030 UPDATE vanZ gene in vanA cluster vanZ; glycopeptide resistance gene cluster; teicoplanin; antibiotic target alteration; vancomycin; glycopeptide antibiotic; model_sequences "UPDATED fmin with 10115 " 500 UPDATE OXA-164 penam; antibiotic inactivation; OXA-58-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-58-like beta-lactamase UPDATED category_aro_cvterm_id with 46517 UPDATED category_aro_accession with 3007728 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-58. " 1212 UPDATE OXA-141 penam; antibiotic inactivation; OXA-2-like beta-lactamase; cephalosporin; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-2-like beta-lactamase UPDATED category_aro_cvterm_id with 46493 UPDATED category_aro_accession with 3007704 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-2. " 633 UPDATE OXA-355 antibiotic inactivation; penam; OXA-229-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-229-like beta-lactamase UPDATED category_aro_cvterm_id with 46498 UPDATED category_aro_accession with 3007709 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-229. " 1217 UPDATE OXA-139 penam; antibiotic inactivation; OXA-24-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-24-like beta-lactamase UPDATED category_aro_cvterm_id with 46500 UPDATED category_aro_accession with 3007711 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-24. " 4378 UPDATE BlaB-17 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences "UPDATED fmin with 100 " 4379 UPDATE BlaB-18 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences "UPDATED fmin with 100 " 5658 UPDATE SHV-191 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences "UPDATED fmin with 0 " 5659 UPDATE SIM-2 carbapenem; penam; cephalosporin; antibiotic inactivation; SIM beta-lactamase; model_sequences "UPDATED fmin with 0 " 5656 UPDATE SHV-171 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences "UPDATED fmin with 100 " 5657 UPDATE SHV-190 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences "UPDATED fmin with 0 " 4370 UPDATE BlaB-1 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences "UPDATED fmin with 100 " 5655 UPDATE SHV-146 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences "UPDATED fmin with 0 " 4376 UPDATE BlaB-15 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences "UPDATED fmin with 0 " 5653 UPDATE SHV-116 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences "UPDATED fmin with 100 " 5650 UPDATE SGM-7 carbapenem; antibiotic inactivation; SGM beta-lactamase; model_sequences "UPDATED fmin with 100 " 5651 UPDATE SHN-1 carbapenem; antibiotic inactivation; SHN beta-lactamase; model_sequences "UPDATED fmin with 100 " 782 UPDATE OXA-63 penam; antibiotic inactivation; OXA beta-lactamase; OXA-63-like beta-lactamase; oxacillin; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-63-like beta-lactamase UPDATED category_aro_cvterm_id with 46521 UPDATED category_aro_accession with 3007732 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-63. " 1100 UPDATE OXA-245 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 1898 UPDATE OXA-379 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 3862 UPDATE OXA-906 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; OXA-50-like beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-50-like beta-lactamase UPDATED category_aro_cvterm_id with 46513 UPDATED category_aro_accession with 3007724 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-50. " 3864 UPDATE OXA-850 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; OXA-50-like beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-50-like beta-lactamase UPDATED category_aro_cvterm_id with 46513 UPDATED category_aro_accession with 3007724 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-50. " 5722 UPDATE VIM-73 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; model_sequences "UPDATED fmin with 0 " 5723 UPDATE YEM-1 carbapenem; antibiotic inactivation; imipenem; YEM beta-lactamase; model_sequences "UPDATED fmin with 100 " 5720 UPDATE VIM-71 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; model_sequences "UPDATED fmin with 0 " 5721 UPDATE VIM-72 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; model_sequences "UPDATED fmin with 0 " 5724 UPDATE ZOG-1 carbapenem; antibiotic inactivation; ZOG beta-lactamase; model_sequences "UPDATED fmin with 100 " 4691 UPDATE IMP-64 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 100 " 4690 UPDATE IMP-63 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 0 " 4693 UPDATE IMP-66 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 0 " 4692 UPDATE IMP-65 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 0 " 4798 UPDATE ORN-4 carbapenem; ORN beta-lactamase; cephalosporin; antibiotic inactivation; model_sequences "UPDATED fmin with 100 " 4799 UPDATE ORN-5 carbapenem; ORN beta-lactamase; cephalosporin; antibiotic inactivation; model_sequences "UPDATED fmin with 100 " 4794 UPDATE OKP-D-1 penam; antibiotic inactivation; OKP beta-lactamase; cephalosporin; model_sequences "UPDATED fmin with 0 " 4795 UPDATE ORN-1 carbapenem; ORN beta-lactamase; cephalosporin; antibiotic inactivation; model_sequences "UPDATED fmin with 100 " 4796 UPDATE ORN-2 carbapenem; ORN beta-lactamase; cephalosporin; antibiotic inactivation; model_sequences "UPDATED fmin with 100 " 4797 UPDATE ORN-3 carbapenem; ORN beta-lactamase; cephalosporin; antibiotic inactivation; model_sequences "UPDATED fmin with 100 " 4790 UPDATE OKP-B-40 penam; antibiotic inactivation; OKP beta-lactamase; cephalosporin; model_sequences "UPDATED fmin with 100 " 4791 UPDATE OKP-B-41 penam; antibiotic inactivation; OKP beta-lactamase; cephalosporin; model_sequences "UPDATED fmin with 100 " 4792 UPDATE OKP-B-45 penam; antibiotic inactivation; OKP beta-lactamase; cephalosporin; model_sequences "UPDATED fmin with 100 " 4694 UPDATE IMP-67 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 0 " 4152 UPDATE ACT-61 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 4153 UPDATE ACT-62 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 4150 UPDATE ACT-59 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 4151 UPDATE ACT-60 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 4156 UPDATE ACT-65 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 4157 UPDATE ACT-66 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 4154 UPDATE ACT-63 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 4155 UPDATE ACT-64 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 4158 UPDATE ACT-67 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 4159 UPDATE ACT-68 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 217 UPDATE vanX gene in vanA cluster antibiotic target alteration; glycopeptide resistance gene cluster; teicoplanin; glycopeptide antibiotic; vanX; vancomycin; model_sequences "UPDATED fmin with 8015 " 213 UPDATE OXA-21 penam; antibiotic inactivation; OXA-2-like beta-lactamase; cephalosporin; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-2-like beta-lactamase UPDATED category_aro_cvterm_id with 46493 UPDATED category_aro_accession with 3007704 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-2. " 4837 UPDATE OXA-502 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 3489 UPDATE OXA-404 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 3488 UPDATE OXA-403 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 3481 UPDATE OXA-364 penam; antibiotic inactivation; OXA-364-like beta-lactamase; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-364-like beta-lactamase UPDATED category_aro_cvterm_id with 46505 UPDATED category_aro_accession with 3007716 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-364. " 3480 UPDATE OXA-346 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 3483 UPDATE OXA-373 antibiotic inactivation; penam; OXA-211-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-211-like beta-lactamase UPDATED category_aro_cvterm_id with 46494 UPDATED category_aro_accession with 3007705 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-211. " 3482 UPDATE OXA-372 OXA-372-like beta-lactamase; antibiotic inactivation; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-372-like beta-lactamase UPDATED category_aro_cvterm_id with 46506 UPDATED category_aro_accession with 3007717 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-372. " 3485 UPDATE OXA-392 penam; antibiotic inactivation; OXA-1-like beta-lactamase; cephalosporin; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-1-like beta-lactamase UPDATED category_aro_cvterm_id with 46485 UPDATED category_aro_accession with 3007696 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-1. " 3487 UPDATE OXA-401 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 3486 UPDATE OXA-400 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4563 UPDATE CTX-M-234 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4562 UPDATE CTX-M-233 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4561 UPDATE CTX-M-232 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4560 UPDATE CTX-M-231 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4567 UPDATE CTX-M-238 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4566 UPDATE CTX-M-237 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4565 UPDATE CTX-M-236 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 100 " 4564 UPDATE CTX-M-235 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4569 UPDATE CTX-M-240 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4568 UPDATE CTX-M-239 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 2396 UPDATE OXA-368 penam; OXA-10-like beta-lactamase; cephalosporin; antibiotic inactivation; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-10-like beta-lactamase UPDATED category_aro_cvterm_id with 46486 UPDATED category_aro_accession with 3007697 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-10. " 5010 UPDATE OXA-698 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 26 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5011 UPDATE OXA-699 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 15 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4899 UPDATE OXA-572 penam; antibiotic inactivation; OXA-22-like beta-lactamase; cephalosporin; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-22-like beta-lactamase UPDATED category_aro_cvterm_id with 46497 UPDATED category_aro_accession with 3007708 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-22. " 4898 UPDATE OXA-569 penam; antibiotic inactivation; OXA-22-like beta-lactamase; cephalosporin; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-22-like beta-lactamase UPDATED category_aro_cvterm_id with 46497 UPDATED category_aro_accession with 3007708 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-22. " 5014 UPDATE OXA-702 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 13 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5015 UPDATE OXA-703 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 16 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5016 UPDATE OXA-704 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 16 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5017 UPDATE OXA-705 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 25 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4893 UPDATE OXA-564 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 4892 UPDATE OXA-563 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 4891 UPDATE OXA-562 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4890 UPDATE OXA-561 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4897 UPDATE OXA-568 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 100 DELETED 35939 " 4896 UPDATE OXA-567 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 4895 UPDATE OXA-566 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 4894 UPDATE OXA-565 antibiotic inactivation; penam; OXA-23-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-23-like beta-lactamase UPDATED category_aro_cvterm_id with 46499 UPDATED category_aro_accession with 3007710 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases, specifically imipenem, derived from OXA-23, first identified in Acinetobacter baumannii. " 1858 UPDATE OXA-387 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4419 UPDATE CARB-33 penam; antibiotic inactivation; CARB beta-lactamase; model_sequences "UPDATED fmin with 0 " 4418 UPDATE CARB-32 penam; antibiotic inactivation; CARB beta-lactamase; model_sequences "UPDATED fmin with 0 " 4417 UPDATE CARB-31 penam; antibiotic inactivation; CARB beta-lactamase; model_sequences "UPDATED fmin with 0 " 4416 UPDATE CARB-30 penam; antibiotic inactivation; CARB beta-lactamase; model_sequences "UPDATED fmin with 0 " 4415 UPDATE CARB-29 penam; antibiotic inactivation; CARB beta-lactamase; model_sequences "UPDATED fmin with 0 " 1853 UPDATE OXA-20 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 " 4413 UPDATE CARB-27 penam; antibiotic inactivation; CARB beta-lactamase; model_sequences "UPDATED fmin with 0 " 4412 UPDATE CARB-26 penam; antibiotic inactivation; CARB beta-lactamase; model_sequences "UPDATED fmin with 0 " 4411 UPDATE CARB-25 penam; antibiotic inactivation; CARB beta-lactamase; model_sequences "UPDATED fmin with 0 " 4410 UPDATE CARB-24 penam; antibiotic inactivation; CARB beta-lactamase; model_sequences "UPDATED fmin with 0 " 4969 UPDATE OXA-644 antibiotic inactivation; penam; OXA-211-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-211-like beta-lactamase UPDATED category_aro_cvterm_id with 46494 UPDATED category_aro_accession with 3007705 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-211. " 4968 UPDATE OXA-643 antibiotic inactivation; penam; OXA-211-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-211-like beta-lactamase UPDATED category_aro_cvterm_id with 46494 UPDATED category_aro_accession with 3007705 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-211. " 4967 UPDATE OXA-642 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 4966 UPDATE OXA-640 penam; OXA-184-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-184-like beta-lactamase UPDATED category_aro_cvterm_id with 46491 UPDATED category_aro_accession with 3007702 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-184. " 4965 UPDATE OXA-639 penam; OXA-184-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-184-like beta-lactamase UPDATED category_aro_cvterm_id with 46491 UPDATED category_aro_accession with 3007702 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-184. " 916 UPDATE OXA-36 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 " 4963 UPDATE OXA-637 penam; OXA-184-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-184-like beta-lactamase UPDATED category_aro_cvterm_id with 46491 UPDATED category_aro_accession with 3007702 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-184. " 4962 UPDATE OXA-636 penam; OXA-184-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-184-like beta-lactamase UPDATED category_aro_cvterm_id with 46491 UPDATED category_aro_accession with 3007702 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-184. " 4961 UPDATE OXA-635 penam; OXA-184-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-184-like beta-lactamase UPDATED category_aro_cvterm_id with 46491 UPDATED category_aro_accession with 3007702 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-184. " 4960 UPDATE OXA-634 penam; OXA-184-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-184-like beta-lactamase UPDATED category_aro_cvterm_id with 46491 UPDATED category_aro_accession with 3007702 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-184. " 1937 UPDATE OXA-118 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; OXA-46-like beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-46-like beta-lactamase UPDATED category_aro_cvterm_id with 46509 UPDATED category_aro_accession with 3007720 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-46. " 5129 UPDATE OXA-827 penam; OXA-10-like beta-lactamase; cephalosporin; antibiotic inactivation; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-10-like beta-lactamase UPDATED category_aro_cvterm_id with 46486 UPDATED category_aro_accession with 3007697 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-10. " 5124 UPDATE OXA-821 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 5125 UPDATE OXA-822 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 5126 UPDATE OXA-823 penam; OXA-10-like beta-lactamase; cephalosporin; antibiotic inactivation; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-10-like beta-lactamase UPDATED category_aro_cvterm_id with 46486 UPDATED category_aro_accession with 3007697 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-10. " 5127 UPDATE OXA-824 penam; OXA-10-like beta-lactamase; cephalosporin; antibiotic inactivation; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-10-like beta-lactamase UPDATED category_aro_cvterm_id with 46486 UPDATED category_aro_accession with 3007697 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-10. " 5120 UPDATE OXA-816 antibiotic inactivation; penam; OXA-23-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-23-like beta-lactamase UPDATED category_aro_cvterm_id with 46499 UPDATED category_aro_accession with 3007710 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases, specifically imipenem, derived from OXA-23, first identified in Acinetobacter baumannii. " 5121 UPDATE OXA-817 antibiotic inactivation; penam; OXA-23-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-23-like beta-lactamase UPDATED category_aro_cvterm_id with 46499 UPDATED category_aro_accession with 3007710 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases, specifically imipenem, derived from OXA-23, first identified in Acinetobacter baumannii. " 5122 UPDATE OXA-819 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 5123 UPDATE OXA-820 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 3467 UPDATE OXA-305 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 3466 UPDATE OXA-304 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 3465 UPDATE OXA-303 penam; antibiotic inactivation; OXA-286-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-286-like beta-lactamase UPDATED category_aro_cvterm_id with 46503 UPDATED category_aro_accession with 3007714 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-286. " 3464 UPDATE OXA-302 penam; antibiotic inactivation; OXA-286-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-286-like beta-lactamase UPDATED category_aro_cvterm_id with 46503 UPDATED category_aro_accession with 3007714 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-286. " 3463 UPDATE OXA-301 antibiotic inactivation; penam; OXA-229-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-229-like beta-lactamase UPDATED category_aro_cvterm_id with 46498 UPDATED category_aro_accession with 3007709 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-229. " 3462 UPDATE OXA-300 antibiotic inactivation; penam; OXA-229-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-229-like beta-lactamase UPDATED category_aro_cvterm_id with 46498 UPDATED category_aro_accession with 3007709 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-229. " 3461 UPDATE OXA-299 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 " 3460 UPDATE OXA-298 penam; antibiotic inactivation; OXA-294-like beta-lactamase; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-294-like beta-lactamase UPDATED category_aro_cvterm_id with 46504 UPDATED category_aro_accession with 3007715 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-294. " 849 UPDATE OXA-138 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 3468 UPDATE OXA-306 penam; antibiotic inactivation; OXA-286-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-286-like beta-lactamase UPDATED category_aro_cvterm_id with 46503 UPDATED category_aro_accession with 3007714 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-286. " 5238 UPDATE OXY-2-15 penam; OXY beta-lactamase; cephalosporin; antibiotic inactivation; monobactam; model_sequences "UPDATED fmin with 0 " 5239 UPDATE PAU-1 carbapenem; antibiotic inactivation; cephalosporin; PAU beta-lactamase; model_sequences "UPDATED fmin with 30 " 5230 UPDATE OXA-946 penam; antibiotic inactivation; OXA-679-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-679-like beta-lactamase UPDATED category_aro_cvterm_id with 46522 UPDATED category_aro_accession with 3007733 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-679. " 1730 UPDATE OXA-235 penam; antibiotic inactivation; OXA-134-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-134-like beta-lactamase UPDATED category_aro_cvterm_id with 46489 UPDATED category_aro_accession with 3007700 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-134. " 1733 UPDATE OXA-415 penam; antibiotic inactivation; OXA-2-like beta-lactamase; cephalosporin; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-2-like beta-lactamase UPDATED category_aro_cvterm_id with 46493 UPDATED category_aro_accession with 3007704 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-2. " 5233 UPDATE OXA-949 penam; antibiotic inactivation; OXA-679-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-679-like beta-lactamase UPDATED category_aro_cvterm_id with 46522 UPDATED category_aro_accession with 3007733 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-679. " 5234 UPDATE OXY-2-11 penam; OXY beta-lactamase; cephalosporin; antibiotic inactivation; monobactam; model_sequences "UPDATED fmin with 0 " 5235 UPDATE OXY-2-12 penam; OXY beta-lactamase; cephalosporin; antibiotic inactivation; monobactam; model_sequences "UPDATED fmin with 0 " 5236 UPDATE OXY-2-13 penam; OXY beta-lactamase; cephalosporin; antibiotic inactivation; monobactam; model_sequences "UPDATED fmin with 0 " 5237 UPDATE OXY-2-14 penam; OXY beta-lactamase; cephalosporin; antibiotic inactivation; monobactam; model_sequences "UPDATED fmin with 94 " 732 UPDATE OXA-237 penam; antibiotic inactivation; OXA-134-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-134-like beta-lactamase UPDATED category_aro_cvterm_id with 46489 UPDATED category_aro_accession with 3007700 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-134. " 1184 UPDATE OXA-182 OXA-143-like beta-lactamase; antibiotic inactivation; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-143-like beta-lactamase UPDATED category_aro_cvterm_id with 46490 UPDATED category_aro_accession with 3007701 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-143. " 758 UPDATE OXA-198 penam; antibiotic inactivation; OXA-198-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-198-like beta-lactamase UPDATED category_aro_cvterm_id with 46492 UPDATED category_aro_accession with 3007703 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-198. " 1595 UPDATE mecB penam; methicillin resistant PBP2; methicillin; antibiotic target replacement; model_sequences "UPDATED fmin with 3737 " 1596 UPDATE OXA-24 penam; antibiotic inactivation; OXA-24-like beta-lactamase; carbapenem; BAL30072; oxacillin; monobactam; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-24-like beta-lactamase UPDATED category_aro_cvterm_id with 46500 UPDATED category_aro_accession with 3007711 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-24. " 1598 UPDATE OXA-101 penam; OXA-10-like beta-lactamase; cephalosporin; antibiotic inactivation; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-10-like beta-lactamase UPDATED category_aro_cvterm_id with 46486 UPDATED category_aro_accession with 3007697 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-10. " 5344 UPDATE PDC-205 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5345 UPDATE PDC-206 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5346 UPDATE PDC-208 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5347 UPDATE PDC-209 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5340 UPDATE PDC-200 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 1020 UPDATE OXA-241 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5342 UPDATE PDC-203 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5343 UPDATE PDC-204 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5348 UPDATE PDC-210 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5349 UPDATE PDC-211 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 605 UPDATE OXA-96 penam; antibiotic inactivation; OXA-58-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-58-like beta-lactamase UPDATED category_aro_cvterm_id with 46517 UPDATED category_aro_accession with 3007728 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-58. " 604 UPDATE OXA-385 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4367 UPDATE AXC-5 AXC beta-lactamase; carbapenem; antibiotic inactivation; model_sequences "UPDATED fmin with 0 " 4366 UPDATE AXC-4 AXC beta-lactamase; carbapenem; antibiotic inactivation; model_sequences "UPDATED fmin with 0 " 4361 UPDATE ALI-2 carbapenem; antibiotic inactivation; ALI beta-lactamase; model_sequences "UPDATED fmin with 100 " 4360 UPDATE ALI-1 carbapenem; antibiotic inactivation; ALI beta-lactamase; model_sequences "UPDATED fmin with 100 " 4363 UPDATE AXC-1 AXC beta-lactamase; carbapenem; antibiotic inactivation; model_sequences "UPDATED fmin with 100 " 4362 UPDATE ANA-1 carbapenem; ANA beta-lactamase; antibiotic inactivation; model_sequences "UPDATED fmin with 100 " 4369 UPDATE BKC-2 carbapenem; antibiotic inactivation; BKC Beta-lactamase; model_sequences "UPDATED fmin with 0 " 4368 UPDATE BEL-4 penam; monobactam; cephalosporin; antibiotic inactivation; BEL beta-lactamase; model_sequences "UPDATED fmin with 0 " 5649 UPDATE SGM-6 carbapenem; antibiotic inactivation; SGM beta-lactamase; model_sequences "UPDATED fmin with 100 " 5648 UPDATE SGM-5 carbapenem; antibiotic inactivation; SGM beta-lactamase; model_sequences "UPDATED fmin with 100 " 5457 UPDATE PDC-328 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5641 UPDATE RUB-1 antibiotic inactivation; cephalosporin; RUB beta-lactamase; model_sequences "UPDATED fmin with 0 " 5640 UPDATE RSD2-2 RSD2 beta-lactamase; carbapenem; cephalosporin; antibiotic inactivation; model_sequences "UPDATED fmin with 0 " 5643 UPDATE SFO-1 carbapenem; antibiotic inactivation; SFO beta-lactamase; model_sequences "UPDATED fmin with 100 " 5642 UPDATE SFC-1 carbapenem; antibiotic inactivation; SFC beta-lactamase; model_sequences "UPDATED fmin with 81 " 5645 UPDATE SGM-2 carbapenem; antibiotic inactivation; SGM beta-lactamase; model_sequences "UPDATED fmin with 100 " 5644 UPDATE SGM-1 carbapenem; antibiotic inactivation; SGM beta-lactamase; model_sequences "UPDATED fmin with 100 " 5647 UPDATE SGM-4 carbapenem; antibiotic inactivation; SGM beta-lactamase; model_sequences "UPDATED fmin with 100 " 635 UPDATE OXA-332 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 1112 UPDATE OXA-58 penam; antibiotic inactivation; OXA-58-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-58-like beta-lactamase UPDATED category_aro_cvterm_id with 46517 UPDATED category_aro_accession with 3007728 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-58. " 1115 UPDATE OXA-435 antibiotic inactivation; penam; OXA-23-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-23-like beta-lactamase UPDATED category_aro_cvterm_id with 46499 UPDATED category_aro_accession with 3007710 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases, specifically imipenem, derived from OXA-23, first identified in Acinetobacter baumannii. " 1118 UPDATE OXA-2 penam; antibiotic inactivation; OXA-2-like beta-lactamase; cephalosporin; carbapenem; ceftazidime; oxacillin; ampicillin; amoxicillin; OXA beta-lactamase; meropenem; model_sequences; ARO_category "UPDATED partial with 0 UPDATED sequence with ATGGCAATCCGAATCTTCGCGATACTTTTCTCCATTTTTTCTCTTGCCACTTTCGCGCATGCGCAAGAAGGCACGCTAGAACGTTCTGACTGGAGGAAGTTTTTCAGCGAATTTCAAGCCAAAGGCACGATAGTTGTGGCAGACGAACGCCAAGCGGATCGTGCCATGTTGGTTTTTGATCCTGTGCGATCGAAGAAACGCTACTCGCCTGCATCGACATTCAAGATACCTCATACACTTTTTGCACTTGATGCAGGCGCTGTTCGTGATGAGTTCCAGATTTTTCGATGGGACGGCGTTAACAGGGGCTTTGCAGGCCACAATCAAGACCAAGATTTGCGATCAGCAATGCGGAATTCTACTGTTTGGGTGTATGAGCTATTTGCAAAGGAAATTGGTGATGACAAAGCTCGGCGCTATTTGAAGAAAATCGACTATGGCAACGCCGATCCTTCGACAAGTAATGGCGATTACTGGATAGAAGGCAGCCTTGCAATCTCGGCGCAGGAGCAAATTGCATTTCTCAGGAAGCTCTATCGTAACGAGCTGCCCTTTCGGGTAGAACATCAGCGCTTGGTCAAGGATCTCATGATTGTGGAAGCCGGTCGCAACTGGATACTGCGTGCAAAGACGGGCTGGGAAGGCCGTATGGGTTGGTGGGTAGGATGGGTTGAGTGGCCGACTGGCTCCGTATTCTTCGCACTGAATATTGATACGCCAAACAGAATGGATGATCTTTTCAAGAGGGAGGCAATCGTGCGGGCAATCCTTCGCTCTATTGAAGCGTTACCGCCCAACCCGGCAGTCAACTCGGACGCTGCGCGATAA UPDATED fmax with 1528 UPDATED accession with X07260.1 UPDATED fmin with 700 UPDATED strand with + UPDATED NCBI_taxonomy_name with Salmonella enterica subsp. enterica serovar Typhimurium UPDATED NCBI_taxonomy_id with 90371 UPDATED NCBI_taxonomy_cvterm_id with 35732 UPDATED accession with CAA30246.1 UPDATED sequence with MAIRIFAILFSIFSLATFAHAQEGTLERSDWRKFFSEFQAKGTIVVADERQADRAMLVFDPVRSKKRYSPASTFKIPHTLFALDAGAVRDEFQIFRWDGVNRGFAGHNQDQDLRSAMRNSTVWVYELFAKEIGDDKARRYLKKIDYGNADPSTSNGDYWIEGSLAISAQEQIAFLRKLYRNELPFRVEHQRLVKDLMIVEAGRNWILRAKTGWEGRMGWWVGWVEWPTGSVFFALNIDTPNRMDDLFKREAIVRAILRSIEALPPNPAVNSDAAR DELETED 35930 UPDATED category_aro_name with OXA-2-like beta-lactamase UPDATED category_aro_cvterm_id with 46493 UPDATED category_aro_accession with 3007704 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-2. " 1449 UPDATE OXA-59 penam; OXA-42-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-42-like beta-lactamase UPDATED category_aro_cvterm_id with 46507 UPDATED category_aro_accession with 3007718 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-42. " 2007 UPDATE OXA-335 penam; antibiotic inactivation; OXA-134-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-134-like beta-lactamase UPDATED category_aro_cvterm_id with 46489 UPDATED category_aro_accession with 3007700 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-134. " 4857 UPDATE OXA-522 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 4584 UPDATE DHT2-1 carbapenem; antibiotic inactivation; DHT2 beta-lactamase; model_sequences "UPDATED fmin with 0 " 4855 UPDATE OXA-520 penam; OXA-10-like beta-lactamase; cephalosporin; antibiotic inactivation; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-10-like beta-lactamase UPDATED category_aro_cvterm_id with 46486 UPDATED category_aro_accession with 3007697 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-10. " 4854 UPDATE OXA-519 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 4581 UPDATE DHA-28 antibiotic inactivation; cephalosporin; cephamycin; DHA beta-lactamase; model_sequences "UPDATED fmin with 0 " 4852 UPDATE OXA-517 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 4583 UPDATE DHA-4 antibiotic inactivation; cephalosporin; cephamycin; DHA beta-lactamase; model_sequences "UPDATED fmin with 100 " 4582 UPDATE DHA-29 antibiotic inactivation; cephalosporin; cephamycin; DHA beta-lactamase; model_sequences "UPDATED fmin with 0 " 4372 UPDATE BlaB-11 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences "UPDATED fmin with 0 " 4789 UPDATE OKP-B-36 penam; antibiotic inactivation; OKP beta-lactamase; cephalosporin; model_sequences "UPDATED fmin with 100 " 4788 UPDATE OKP-B-34 penam; antibiotic inactivation; OKP beta-lactamase; cephalosporin; model_sequences "UPDATED fmin with 100 " 4787 UPDATE OKP-B-24 penam; antibiotic inactivation; OKP beta-lactamase; cephalosporin; model_sequences "UPDATED fmin with 0 " 4786 UPDATE OKP-B-23 penam; antibiotic inactivation; OKP beta-lactamase; cephalosporin; model_sequences "UPDATED fmin with 100 " 4785 UPDATE OKP-B-22 penam; antibiotic inactivation; OKP beta-lactamase; cephalosporin; model_sequences "UPDATED fmin with 100 " 4784 UPDATE OKP-B-21 penam; antibiotic inactivation; OKP beta-lactamase; cephalosporin; model_sequences "UPDATED fmin with 100 " 4783 UPDATE OKP-B-16 penam; antibiotic inactivation; OKP beta-lactamase; cephalosporin; model_sequences "UPDATED fmin with 0 " 5654 UPDATE SHV-132 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences "UPDATED fmin with 100 " 4371 UPDATE BlaB-10 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences "UPDATED fmin with 0 " 4149 UPDATE ACT-58 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 2 " 4148 UPDATE ACT-57 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 4145 UPDATE ACT-54 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 4144 UPDATE ACT-53 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 4147 UPDATE ACT-56 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 4146 UPDATE ACT-55 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 4141 UPDATE ACT-50 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 4140 UPDATE ACT-49 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 4143 UPDATE ACT-52 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 4142 UPDATE ACT-51 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 3856 UPDATE OXA-846 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; OXA-50-like beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-50-like beta-lactamase UPDATED category_aro_cvterm_id with 46513 UPDATED category_aro_accession with 3007724 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-50. " 4374 UPDATE BlaB-13 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences "UPDATED fmin with 0 " 4375 UPDATE BlaB-14 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences "UPDATED fmin with 100 " 4814 UPDATE OXA-114n OXA-114-like beta-lactamase; penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-114-like beta-lactamase UPDATED category_aro_cvterm_id with 46487 UPDATED category_aro_accession with 3007698 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-114. " 4820 UPDATE OXA-114u OXA-114-like beta-lactamase; penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-114-like beta-lactamase UPDATED category_aro_cvterm_id with 46487 UPDATED category_aro_accession with 3007698 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-114. " 191 UPDATE OXA-199 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 190 UPDATE OXA-195 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4558 UPDATE CTX-M-229 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4559 UPDATE CTX-M-230 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4556 UPDATE CTX-M-227 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4557 UPDATE CTX-M-228 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4554 UPDATE CTX-M-225 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 72 " 4555 UPDATE CTX-M-226 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4552 UPDATE CTX-M-223 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4553 UPDATE CTX-M-224 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 100 " 4550 UPDATE CTX-M-221 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4551 UPDATE CTX-M-222 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 5003 UPDATE OXA-691 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 13 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5002 UPDATE OXA-690 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 11 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5001 UPDATE OXA-689 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 14 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5000 UPDATE OXA-688 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 31 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5007 UPDATE OXA-695 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 18 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5006 UPDATE OXA-694 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 27 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5005 UPDATE OXA-693 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 13 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5004 UPDATE OXA-692 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 13 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5009 UPDATE OXA-697 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 36 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5008 UPDATE OXA-696 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 12 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 902 UPDATE OXA-92 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4428 UPDATE CARB-44 penam; antibiotic inactivation; CARB beta-lactamase; model_sequences "UPDATED fmin with 100 " 4429 UPDATE CARB-45 penam; antibiotic inactivation; CARB beta-lactamase; model_sequences "UPDATED fmin with 100 " 4422 UPDATE CARB-36 penam; antibiotic inactivation; CARB beta-lactamase; model_sequences "UPDATED fmin with 0 " 4423 UPDATE CARB-38 penam; antibiotic inactivation; CARB beta-lactamase; model_sequences "UPDATED fmin with 0 " 1841 UPDATE OXA-76 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4421 UPDATE CARB-35 penam; antibiotic inactivation; CARB beta-lactamase; model_sequences "UPDATED fmin with 0 " 4426 UPDATE CARB-42 penam; antibiotic inactivation; CARB beta-lactamase; model_sequences "UPDATED fmin with 0 " 4427 UPDATE CARB-43 penam; antibiotic inactivation; CARB beta-lactamase; model_sequences "UPDATED fmin with 0 " 1845 UPDATE OXA-312 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 1844 UPDATE OXA-128 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4958 UPDATE OXA-632 penam; OXA-184-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-184-like beta-lactamase UPDATED category_aro_cvterm_id with 46491 UPDATED category_aro_accession with 3007702 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-184. " 4959 UPDATE OXA-633 penam; OXA-184-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-184-like beta-lactamase UPDATED category_aro_cvterm_id with 46491 UPDATED category_aro_accession with 3007702 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-184. " 4952 UPDATE OXA-626 penam; OXA-184-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-184-like beta-lactamase UPDATED category_aro_cvterm_id with 46491 UPDATED category_aro_accession with 3007702 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-184. " 4953 UPDATE OXA-627 penam; OXA-184-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-184-like beta-lactamase UPDATED category_aro_cvterm_id with 46491 UPDATED category_aro_accession with 3007702 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-184. " 4950 UPDATE OXA-624 penam; OXA-184-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-184-like beta-lactamase UPDATED category_aro_cvterm_id with 46491 UPDATED category_aro_accession with 3007702 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-184. " 4951 UPDATE OXA-625 penam; OXA-184-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-184-like beta-lactamase UPDATED category_aro_cvterm_id with 46491 UPDATED category_aro_accession with 3007702 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-184. " 4956 UPDATE OXA-630 penam; OXA-184-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-184-like beta-lactamase UPDATED category_aro_cvterm_id with 46491 UPDATED category_aro_accession with 3007702 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-184. " 4957 UPDATE OXA-631 penam; OXA-184-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-184-like beta-lactamase UPDATED category_aro_cvterm_id with 46491 UPDATED category_aro_accession with 3007702 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-184. " 4954 UPDATE OXA-628 penam; OXA-184-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-184-like beta-lactamase UPDATED category_aro_cvterm_id with 46491 UPDATED category_aro_accession with 3007702 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-184. " 4955 UPDATE OXA-629 penam; OXA-184-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-184-like beta-lactamase UPDATED category_aro_cvterm_id with 46491 UPDATED category_aro_accession with 3007702 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-184. " 243 UPDATE OXA-9 OXA-9-like beta-lactamase; penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-9-like beta-lactamase UPDATED category_aro_cvterm_id with 46524 UPDATED category_aro_accession with 3007735 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-9. " 5139 UPDATE OXA-840 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 5138 UPDATE OXA-839 OXA-114-like beta-lactamase; penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-114-like beta-lactamase UPDATED category_aro_cvterm_id with 46487 UPDATED category_aro_accession with 3007698 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-114. " 5137 UPDATE OXA-836 penam; OXA-10-like beta-lactamase; cephalosporin; antibiotic inactivation; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-10-like beta-lactamase UPDATED category_aro_cvterm_id with 46486 UPDATED category_aro_accession with 3007697 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-10. " 1907 UPDATE vanS gene in vanA cluster glycopeptide resistance gene cluster; vanS; teicoplanin; glycopeptide antibiotic; antibiotic target alteration; vancomycin; model_sequences "UPDATED fmin with 4648 " 5135 UPDATE OXA-833 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 26 DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 5134 UPDATE OXA-832 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 1902 UPDATE OXA-246 penam; OXA-10-like beta-lactamase; cephalosporin; antibiotic inactivation; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-10-like beta-lactamase UPDATED category_aro_cvterm_id with 46486 UPDATED category_aro_accession with 3007697 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-10. " 5132 UPDATE OXA-830 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 " 5131 UPDATE OXA-829 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5130 UPDATE OXA-828 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 3452 UPDATE OXA-288 penam; antibiotic inactivation; OXA-286-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-286-like beta-lactamase UPDATED category_aro_cvterm_id with 46503 UPDATED category_aro_accession with 3007714 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-286. " 3453 UPDATE OXA-289 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 " 3450 UPDATE OXA-285 penam; antibiotic inactivation; OXA-134-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-134-like beta-lactamase UPDATED category_aro_cvterm_id with 46489 UPDATED category_aro_accession with 3007700 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-134. " 3451 UPDATE OXA-287 penam; antibiotic inactivation; OXA-286-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-286-like beta-lactamase UPDATED category_aro_cvterm_id with 46503 UPDATED category_aro_accession with 3007714 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-286. " 3456 UPDATE OXA-293 penam; antibiotic inactivation; OXA-286-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-286-like beta-lactamase UPDATED category_aro_cvterm_id with 46503 UPDATED category_aro_accession with 3007714 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-286. " 3457 UPDATE OXA-294 penam; antibiotic inactivation; OXA-294-like beta-lactamase; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-294-like beta-lactamase UPDATED category_aro_cvterm_id with 46504 UPDATED category_aro_accession with 3007715 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-294. " 3454 UPDATE OXA-291 penam; antibiotic inactivation; OXA-286-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-286-like beta-lactamase UPDATED category_aro_cvterm_id with 46503 UPDATED category_aro_accession with 3007714 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-286. " 3455 UPDATE OXA-292 penam; antibiotic inactivation; OXA-286-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-286-like beta-lactamase UPDATED category_aro_cvterm_id with 46503 UPDATED category_aro_accession with 3007714 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-286. " 3458 UPDATE OXA-295 penam; antibiotic inactivation; OXA-294-like beta-lactamase; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-294-like beta-lactamase UPDATED category_aro_cvterm_id with 46504 UPDATED category_aro_accession with 3007715 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-294. " 3459 UPDATE OXA-297 penam; antibiotic inactivation; OXA-294-like beta-lactamase; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-294-like beta-lactamase UPDATED category_aro_cvterm_id with 46504 UPDATED category_aro_accession with 3007715 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-294. " 1186 UPDATE OXA-327 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 5229 UPDATE OXA-945 OXA-143-like beta-lactamase; antibiotic inactivation; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-143-like beta-lactamase UPDATED category_aro_cvterm_id with 46490 UPDATED category_aro_accession with 3007701 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-143. " 5228 UPDATE OXA-943 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 100 DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 5223 UPDATE OXA-938 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 100 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5222 UPDATE OXA-937 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; OXA-50-like beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-50-like beta-lactamase UPDATED category_aro_cvterm_id with 46513 UPDATED category_aro_accession with 3007724 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-50. " 5221 UPDATE OXA-935 penam; OXA-10-like beta-lactamase; cephalosporin; antibiotic inactivation; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 100 DELETED 35939 UPDATED category_aro_name with OXA-10-like beta-lactamase UPDATED category_aro_cvterm_id with 46486 UPDATED category_aro_accession with 3007697 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-10. " 5220 UPDATE OXA-932 penam; OXA-10-like beta-lactamase; cephalosporin; antibiotic inactivation; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-10-like beta-lactamase UPDATED category_aro_cvterm_id with 46486 UPDATED category_aro_accession with 3007697 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-10. " 5227 UPDATE OXA-942 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 100 DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 5226 UPDATE OXA-941 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 100 DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 5225 UPDATE OXA-940 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 100 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5224 UPDATE OXA-939 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 100 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5357 UPDATE PDC-21a PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5356 UPDATE PDC-219 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5355 UPDATE PDC-218 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5354 UPDATE PDC-217 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5353 UPDATE PDC-216 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5352 UPDATE PDC-215 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5351 UPDATE PDC-214 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5350 UPDATE PDC-213 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5359 UPDATE PDC-22 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5358 UPDATE PDC-21b PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 1694 UPDATE OXA-353 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 1690 UPDATE OXA-317 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4310 UPDATE ADC-244 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4311 UPDATE ADC-245 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4312 UPDATE ADC-246 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4313 UPDATE ADC-247 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4314 UPDATE ADC-248 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4315 UPDATE ADC-249 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4316 UPDATE ADC-250 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 86 " 4317 UPDATE ADC-251 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4318 UPDATE ADC-252 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4319 UPDATE ADC-253 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 611 UPDATE OXA-328 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 617 UPDATE OXA-147 penam; OXA-10-like beta-lactamase; cephalosporin; antibiotic inactivation; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-10-like beta-lactamase UPDATED category_aro_cvterm_id with 46486 UPDATED category_aro_accession with 3007697 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-10. " 1276 UPDATE OXA-210 penam; antibiotic inactivation; OXA-2-like beta-lactamase; cephalosporin; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-2-like beta-lactamase UPDATED category_aro_cvterm_id with 46493 UPDATED category_aro_accession with 3007704 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-2. " 615 UPDATE OXA-211 antibiotic inactivation; penam; OXA-211-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-211-like beta-lactamase UPDATED category_aro_cvterm_id with 46494 UPDATED category_aro_accession with 3007705 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-211. " 1496 UPDATE OXA-224 penam; antibiotic inactivation; OXA-1-like beta-lactamase; cephalosporin; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-1-like beta-lactamase UPDATED category_aro_cvterm_id with 46485 UPDATED category_aro_accession with 3007696 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-1. " 4228 UPDATE ADC-158 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4229 UPDATE ADC-160 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4224 UPDATE ADC-154 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4225 UPDATE ADC-155 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4226 UPDATE ADC-156 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 497 UPDATE OXA-79 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4220 UPDATE ADC-150 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4221 UPDATE ADC-151 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4222 UPDATE ADC-152 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4223 UPDATE ADC-153 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 5586 UPDATE PDC-459 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5587 UPDATE PDC-46 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5584 UPDATE PDC-457 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 100 " 5585 UPDATE PDC-458 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5582 UPDATE PDC-455 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 21 UPDATE OXA-329 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 5580 UPDATE PDC-453 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 23 UPDATE OXA-371 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 28 UPDATE OXA-45 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 " 5588 UPDATE PDC-460 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5589 UPDATE PDC-462 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5037 UPDATE OXA-727 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; OXA-727-like beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-727-like beta-lactamase UPDATED category_aro_cvterm_id with 46523 UPDATED category_aro_accession with 3007734 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-727. " 5031 UPDATE OXA-719 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 8 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4138 UPDATE ACT-47 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 4139 UPDATE ACT-48 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 5261 UPDATE PDC-125 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 4130 UPDATE ACT-39 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 4131 UPDATE ACT-40 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 4132 UPDATE ACT-41 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 4133 UPDATE ACT-42 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 4134 UPDATE ACT-43 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 4135 UPDATE ACT-44 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 4136 UPDATE ACT-45 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 4137 UPDATE ACT-46 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 5692 UPDATE VIM-41 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; model_sequences "UPDATED fmin with 0 " 5693 UPDATE VIM-44 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; model_sequences "UPDATED fmin with 0 " 5690 UPDATE VHW-1 antibiotic inactivation; penam; carbapenem; cephalosporin; VHW beta-lactamase; ampicillin; model_sequences "UPDATED fmin with 100 " 5691 UPDATE VIM-40 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; model_sequences "UPDATED fmin with 0 " 5696 UPDATE VIM-47 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; model_sequences "UPDATED fmin with 0 " 5697 UPDATE VIM-48 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; model_sequences "UPDATED fmin with 0 " 5694 UPDATE VIM-45 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; model_sequences "UPDATED fmin with 0 " 5695 UPDATE VIM-46 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; model_sequences "UPDATED fmin with 0 " 5698 UPDATE VIM-49 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; model_sequences "UPDATED fmin with 0 " 5699 UPDATE VIM-50 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; model_sequences "UPDATED fmin with 0 " 2136 UPDATE Escherichia coli 16S rRNA (rrsB) mutation conferring resistance to kanamycin A kanamycin A; antibiotic target alteration; aminoglycoside antibiotic; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; model_sequences "UPDATED fmin with 4166658 " 1870 UPDATE OXA-66 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 1065 UPDATE OXA-384 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 1871 UPDATE OXA-389 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4046 UPDATE OXA-540 penam; antibiotic inactivation; OXA-2-like beta-lactamase; cephalosporin; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-2-like beta-lactamase UPDATED category_aro_cvterm_id with 46493 UPDATED category_aro_accession with 3007704 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-2. " 4047 UPDATE OXA-779 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; OXA-46-like beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-46-like beta-lactamase UPDATED category_aro_cvterm_id with 46509 UPDATED category_aro_accession with 3007720 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-46. " 4048 UPDATE OXA-838 penam; antibiotic inactivation; OXA-2-like beta-lactamase; cephalosporin; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-2-like beta-lactamase UPDATED category_aro_cvterm_id with 46493 UPDATED category_aro_accession with 3007704 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-2. " 4049 UPDATE OXA-539 penam; antibiotic inactivation; OXA-2-like beta-lactamase; cephalosporin; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-2-like beta-lactamase UPDATED category_aro_cvterm_id with 46493 UPDATED category_aro_accession with 3007704 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-2. " 5961 UPDATE Pseudomonas aeruginosa ampR with mutation conferring resistance to aztreonam penam; antibiotic inactivation; aztreonam; carbapenem; cephalosporin; PDC beta-lactamase; monobactam; ampC-type beta-lactamase; ARO_category "DELETED 35962 " 977 UPDATE OXA-112 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4549 UPDATE CTX-M-220 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4548 UPDATE CTX-M-219 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 100 " 4541 UPDATE CTX-M-212 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4540 UPDATE CTX-M-211 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4543 UPDATE CTX-M-214 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4542 UPDATE CTX-M-213 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4545 UPDATE CTX-M-216 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4544 UPDATE CTX-M-215 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4547 UPDATE CTX-M-218 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4546 UPDATE CTX-M-217 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 5583 UPDATE PDC-456 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 4534 UPDATE CTX-M-205 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4827 UPDATE OXA-395 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; OXA-50-like beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-50-like beta-lactamase UPDATED category_aro_cvterm_id with 46513 UPDATED category_aro_accession with 3007724 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-50. " 2132 UPDATE Mycobacterium tuberculosis 16S rRNA mutation conferring resistance to kanamycin kanamycin A; antibiotic target alteration; aminoglycoside antibiotic; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; model_sequences "UPDATED fmin with 1471845 " 4536 UPDATE CTX-M-207 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 100 " 1087 UPDATE OXA-253 OXA-143-like beta-lactamase; antibiotic inactivation; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-143-like beta-lactamase UPDATED category_aro_cvterm_id with 46490 UPDATED category_aro_accession with 3007701 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-143. " 4537 UPDATE CTX-M-208 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 5038 UPDATE OXA-728 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; OXA-727-like beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-727-like beta-lactamase UPDATED category_aro_cvterm_id with 46523 UPDATED category_aro_accession with 3007734 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-727. " 5039 UPDATE OXA-729 penam; antibiotic inactivation; OXA-55-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 100 DELETED 35930 UPDATED category_aro_name with OXA-55-like beta-lactamase UPDATED category_aro_cvterm_id with 46516 UPDATED category_aro_accession with 3007727 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapanem-hydrolyzing class D OXA beta-lactamases derived from OXA-55. " 5036 UPDATE OXA-726 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; OXA-12-like beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 100 DELETED 35939 UPDATED category_aro_name with OXA-12-like beta-lactamase UPDATED category_aro_cvterm_id with 46488 UPDATED category_aro_accession with 3007699 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-12. " 4530 UPDATE CTX-M-201 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 5034 UPDATE OXA-722 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 12 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5035 UPDATE OXA-723 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 17 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5032 UPDATE OXA-720 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 19 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5033 UPDATE OXA-721 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 11 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5030 UPDATE OXA-718 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 11 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4823 UPDATE OXA-114x OXA-114-like beta-lactamase; penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-114-like beta-lactamase UPDATED category_aro_cvterm_id with 46487 UPDATED category_aro_accession with 3007698 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-114. " 4435 UPDATE CARB-51 penam; antibiotic inactivation; CARB beta-lactamase; model_sequences "UPDATED fmin with 48 " 4434 UPDATE CARB-50 penam; antibiotic inactivation; CARB beta-lactamase; model_sequences "UPDATED fmin with 0 " 1874 UPDATE OXA-196 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4436 UPDATE CARB-52 penam; antibiotic inactivation; CARB beta-lactamase; model_sequences "UPDATED fmin with 0 " 4431 UPDATE CARB-47 penam; antibiotic inactivation; CARB beta-lactamase; model_sequences "UPDATED fmin with 100 " 4430 UPDATE CARB-46 penam; antibiotic inactivation; CARB beta-lactamase; model_sequences "UPDATED fmin with 100 " 4433 UPDATE CARB-49 penam; antibiotic inactivation; CARB beta-lactamase; model_sequences "UPDATED fmin with 0 " 4432 UPDATE CARB-48 penam; antibiotic inactivation; CARB beta-lactamase; model_sequences "UPDATED fmin with 100 " 2133 UPDATE Mycobacterium tuberculosis 16S rRNA mutation conferring resistance to viomycin peptide antibiotic; antibiotic target alteration; 16s rRNA with mutation conferring resistance to peptide antibiotics; viomycin; model_sequences "UPDATED fmin with 1471845 " 4533 UPDATE CTX-M-204 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4439 UPDATE CARB-55 penam; antibiotic inactivation; CARB beta-lactamase; model_sequences "UPDATED fmin with 100 " 4438 UPDATE CARB-54 penam; antibiotic inactivation; CARB beta-lactamase; model_sequences "UPDATED fmin with 100 " 4945 UPDATE OXA-619 penam; OXA-184-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-184-like beta-lactamase UPDATED category_aro_cvterm_id with 46491 UPDATED category_aro_accession with 3007702 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-184. " 4944 UPDATE OXA-618 penam; OXA-184-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-184-like beta-lactamase UPDATED category_aro_cvterm_id with 46491 UPDATED category_aro_accession with 3007702 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-184. " 4947 UPDATE OXA-621 penam; OXA-184-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-184-like beta-lactamase UPDATED category_aro_cvterm_id with 46491 UPDATED category_aro_accession with 3007702 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-184. " 4946 UPDATE OXA-620 penam; OXA-184-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-184-like beta-lactamase UPDATED category_aro_cvterm_id with 46491 UPDATED category_aro_accession with 3007702 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-184. " 973 UPDATE OXA-378 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4940 UPDATE OXA-614 penam; OXA-184-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-184-like beta-lactamase UPDATED category_aro_cvterm_id with 46491 UPDATED category_aro_accession with 3007702 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-184. " 4943 UPDATE OXA-617 penam; OXA-184-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-184-like beta-lactamase UPDATED category_aro_cvterm_id with 46491 UPDATED category_aro_accession with 3007702 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-184. " 4942 UPDATE OXA-616 penam; OXA-184-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-184-like beta-lactamase UPDATED category_aro_cvterm_id with 46491 UPDATED category_aro_accession with 3007702 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-184. " 5581 UPDATE PDC-454 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 4949 UPDATE OXA-623 penam; OXA-184-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-184-like beta-lactamase UPDATED category_aro_cvterm_id with 46491 UPDATED category_aro_accession with 3007702 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-184. " 4948 UPDATE OXA-622 penam; OXA-184-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-184-like beta-lactamase UPDATED category_aro_cvterm_id with 46491 UPDATED category_aro_accession with 3007702 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-184. " 978 UPDATE OXA-134 penam; antibiotic inactivation; OXA-134-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-134-like beta-lactamase UPDATED category_aro_cvterm_id with 46489 UPDATED category_aro_accession with 3007700 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-134. " 186 UPDATE OXA-12 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; OXA-12-like beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-12-like beta-lactamase UPDATED category_aro_cvterm_id with 46488 UPDATED category_aro_accession with 3007699 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-12. " 187 UPDATE OXA-348 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 185 UPDATE OXA-232 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 2111 UPDATE Mycobacteroides chelonae 16S rRNA mutation conferring resistance to tobramycin antibiotic target alteration; aminoglycoside antibiotic; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; tobramycin; model_sequences "UPDATED fmin with 0 " 2113 UPDATE Escherichia coli 16S rRNA (rrsB) mutation conferring resistance to tobramycin antibiotic target alteration; aminoglycoside antibiotic; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; tobramycin; model_sequences "UPDATED fmin with 4166658 " 2116 UPDATE Pasteurella multocida 16S rRNA mutation conferring resistance to spectinomycin antibiotic target alteration; aminoglycoside antibiotic; spectinomycin; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; model_sequences "UPDATED fmin with 341426 " 5108 UPDATE OXA-803 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 5109 UPDATE OXA-804 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 4924 UPDATE OXA-598 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 5102 UPDATE OXA-797 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5103 UPDATE OXA-798 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5100 UPDATE OXA-795 penam; OXA-10-like beta-lactamase; cephalosporin; antibiotic inactivation; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-10-like beta-lactamase UPDATED category_aro_cvterm_id with 46486 UPDATED category_aro_accession with 3007697 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-10. " 5101 UPDATE OXA-796 penam; antibiotic inactivation; OXA-1-like beta-lactamase; cephalosporin; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 100 DELETED 35939 UPDATED category_aro_name with OXA-1-like beta-lactamase UPDATED category_aro_cvterm_id with 46485 UPDATED category_aro_accession with 3007696 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-1. " 5106 UPDATE OXA-801 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 5107 UPDATE OXA-802 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 5104 UPDATE OXA-799 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5105 UPDATE OXA-800 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 3449 UPDATE OXA-284 penam; antibiotic inactivation; OXA-134-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-134-like beta-lactamase UPDATED category_aro_cvterm_id with 46489 UPDATED category_aro_accession with 3007700 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-134. " 3448 UPDATE OXA-283 penam; antibiotic inactivation; OXA-134-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-134-like beta-lactamase UPDATED category_aro_cvterm_id with 46489 UPDATED category_aro_accession with 3007700 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-134. " 3445 UPDATE OXA-280 antibiotic inactivation; penam; OXA-211-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-211-like beta-lactamase UPDATED category_aro_cvterm_id with 46494 UPDATED category_aro_accession with 3007705 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-211. " 3444 UPDATE OXA-279 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 " 3447 UPDATE OXA-282 penam; antibiotic inactivation; OXA-134-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-134-like beta-lactamase UPDATED category_aro_cvterm_id with 46489 UPDATED category_aro_accession with 3007700 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-134. " 3446 UPDATE OXA-281 antibiotic inactivation; penam; OXA-211-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-211-like beta-lactamase UPDATED category_aro_cvterm_id with 46494 UPDATED category_aro_accession with 3007705 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-211. " 3441 UPDATE OXA-275 antibiotic inactivation; penam; OXA-274-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-274-like beta-lactamase UPDATED category_aro_cvterm_id with 46502 UPDATED category_aro_accession with 3007713 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-274. " 3440 UPDATE OXA-273 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 3443 UPDATE OXA-277 penam; antibiotic inactivation; OXA-134-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-134-like beta-lactamase UPDATED category_aro_cvterm_id with 46489 UPDATED category_aro_accession with 3007700 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-134. " 3442 UPDATE OXA-276 penam; antibiotic inactivation; OXA-134-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-134-like beta-lactamase UPDATED category_aro_cvterm_id with 46489 UPDATED category_aro_accession with 3007700 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-134. " 2026 UPDATE OXA-84 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 2755 UPDATE ANT(3'')-IIc antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; model_sequences; model_param "UPDATED partial with 0 UPDATED sequence with ATGTCCGAAACCTTGCAACTCGAACAGTTAACAGGATCTTTACAGCAGCTTTTGGGTGAATCCCTATTTGCCATTTATCTGTATGGTTCAGCTGTTGATGGCGGGCTAGGTCCAGAAAGTGATCTGGATGTTTTGGTTGTGGTGAGTCAAGCTCTGACACTCCAGCAACGACAGCAACTGGCAGAAACCTTATTAAAAATTTCGTATCCAATTGGGGCAGCACAGCGTGCACTTGAAGTCACCATCGTACTTAAAGCGCAAATTCTTTCAGGCAGTTATCCACTCAGCTACGAACTACAATTTGGAGAATGGTTACGGGAGGAGTTAAACCAAGGTGCTTTGCTCCGCACACATACAGACCCTGATCTGAGTATTTTGCTGAAGAAAGCACAAGTGCATCATCGTAGTTTGTTGGGGCCAAGTTTGACACAGTGGTCAACGGCAATTCCTGAACAGCACCTCTGGCAGGCAATGGCAGACACCTATCCCTCGATTGTGGAACATTGGGATGAGGATGCCGATGAGCGTAATCAAATTTTGGCCTTATGCCGTATTTATTTTAGTTTGGTGACGAGTGAGATTGTGCCTAAAGACCAGGCCGCACACTGGGTGATAGCTCAGTTACCGTCGCAGCATCAACCCATTTTGCAGCGCATGATCCAAGAATATAAAGGTGAGATAGGCAAGCAAAGCTGGCAACAACAGCATCAGGCTTTAGGAGCTGTTGTTGACTTCCTGAGTTCAAAAATTGATGAACAATTTAAGAAGAAGAGTAGCCTGATCAAATAA UPDATED fmax with 124807 UPDATED accession with AYEQ01000163.1 UPDATED fmin with 124018 UPDATED strand with - UPDATED NCBI_taxonomy_name with Acinetobacter gyllenbergii NIPH 230 UPDATED NCBI_taxonomy_id with 1217658 UPDATED NCBI_taxonomy_cvterm_id with 46540 UPDATED accession with ESK39014.1 UPDATED sequence with MSETLQLEQLTGSLQQLLGESLFAIYLYGSAVDGGLGPESDLDVLVVVSQALTLQQRQQLAETLLKISYPIGAAQRALEVTIVLKAQILSGSYPLSYELQFGEWLREELNQGALLRTHTDPDLSILLKKAQVHHRSLLGPSLTQWSTAIPEQHLWQAMADTYPSIVEHWDEDADERNQILALCRIYFSLVTSEIVPKDQAAHWVIAQLPSQHQPILQRMIQEYKGEIGKQSWQQQHQALGAVVDFLSSKIDEQFKKKSSLIK UPDATED param_value with 400 " 2752 UPDATE ANT(3'')-IIa antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; model_sequences; model_param "UPDATED partial with 0 UPDATED sequence with ATGCCTGATTTCATTCAGTTAGAATATCTACAAGAAAAATTACAGCAACTTTTAGCGGAATCATTATTTGCAATCTATCTTTATGGTTCAGCTGTTGATGGTGGCTTAGGGCCAGAAAGTGACCTTGATGTTCTGGTCGTGGTTACTCAACCATTAACATCTGCTTTACGCGAGCAGCTTGCACAAGAATTACTAAAAATTTCACAGCCTGTTGGGGAATTACAAAGACCATTAGAAGTTACTATTTTATTAAAAGATGAGATTCAGGCTGGAAATTATCCTTTAAGTTATGAAATGCAGTTTGGTGAATGGCTACGTGAAGAACTTAAAGAAGGTGGAACATTAAGTTCGCAGAAAGACCCAGATATTAGTATATTGCTTAGAAAAGCGAGATTTCATCATACAGTTTTATTTGGTCCAGCTTTGGACCAATGGGCACCTGAAATTTCTGATCAAGAACTATGGCAAGCAATGTCTGATACTTATCCCGAAATTGTAGCTCATTGGGATGAGGATGCAGATGAAAGAAACCAGATTTTAGCTTTATGCCGGATCTATTTTAGTTTAGTCATGAAGGATATTGCTTCAAAAGACAATGCAGCTCGATGGGTTATGCCTCAGCTTCCTCCTGAGCAGAAATTCGTATTGCAGCGGCTTATACAGGAATATAGAGGGGAAATAGGCAAACAAAATTGGCAAGAGGAACATTATGCTTTGCAGCCTATTGTTAATTTTCTGAGTTCAAAAATTGAAGAGCAGTTTGAGCAGAAAAGAAATTTGATCACATAA UPDATED fmax with 35369 UPDATED accession with GG704579.1 UPDATED fmin with 34580 UPDATED strand with - UPDATED NCBI_taxonomy_name with Acinetobacter baumannii ATCC 19606 = CIP 70.34 = JCM 6841 UPDATED NCBI_taxonomy_id with 575584 UPDATED NCBI_taxonomy_cvterm_id with 35598 UPDATED accession with EEX02086.1 UPDATED sequence with MPDFIQLEYLQEKLQQLLAESLFAIYLYGSAVDGGLGPESDLDVLVVVTQPLTSALREQLAQELLKISQPVGELQRPLEVTILLKDEIQAGNYPLSYEMQFGEWLREELKEGGTLSSQKDPDISILLRKARFHHTVLFGPALDQWAPEISDQELWQAMSDTYPEIVAHWDEDADERNQILALCRIYFSLVMKDIASKDNAARWVMPQLPPEQKFVLQRLIQEYRGEIGKQNWQEEHYALQPIVNFLSSKIEEQFEQKRNLIT UPDATED param_value with 400 " 2023 UPDATE OXA-132 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 656 UPDATE OXA-219 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5216 UPDATE OXA-925 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 " 5217 UPDATE OXA-927 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5214 UPDATE OXA-923 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 5215 UPDATE OXA-924 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 5212 UPDATE OXA-921 penam; antibiotic inactivation; OXA-1-like beta-lactamase; cephalosporin; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-1-like beta-lactamase UPDATED category_aro_cvterm_id with 46485 UPDATED category_aro_accession with 3007696 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-1. " 5213 UPDATE OXA-922 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 5210 UPDATE OXA-919 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 100 DELETED 35939 " 5211 UPDATE OXA-920 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 5218 UPDATE OXA-928 penam; OXA-10-like beta-lactamase; cephalosporin; antibiotic inactivation; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-10-like beta-lactamase UPDATED category_aro_cvterm_id with 46486 UPDATED category_aro_accession with 3007697 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-10. " 5219 UPDATE OXA-929 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 779 UPDATE OXA-350 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 73 UPDATE OXA-35 penam; OXA-10-like beta-lactamase; cephalosporin; antibiotic inactivation; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-10-like beta-lactamase UPDATED category_aro_cvterm_id with 46486 UPDATED category_aro_accession with 3007697 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-10. " 5362 UPDATE PDC-222 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5363 UPDATE PDC-223 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5360 UPDATE PDC-220 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5361 UPDATE PDC-221 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5366 UPDATE PDC-227 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5367 UPDATE PDC-228 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5364 UPDATE PDC-224 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5365 UPDATE PDC-226 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 4597 UPDATE ECV-1 carbapenem; antibiotic inactivation; ECV beta-lactamase; model_sequences "UPDATED fmin with 100 " 5368 UPDATE PDC-229 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5369 UPDATE PDC-230 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 1686 UPDATE OXA-34 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 " 4303 UPDATE ADC-238 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4302 UPDATE ADC-237 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 1269 UPDATE OXA-192 penam; antibiotic inactivation; OXA beta-lactamase; OXA-63-like beta-lactamase; oxacillin; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-63-like beta-lactamase UPDATED category_aro_cvterm_id with 46521 UPDATED category_aro_accession with 3007732 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-63. " 4300 UPDATE ADC-235 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 10 " 4307 UPDATE ADC-241 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4306 UPDATE ADC-240 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 86 " 4305 UPDATE ADC-24 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4304 UPDATE ADC-239 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4309 UPDATE ADC-243 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4308 UPDATE ADC-242 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4917 UPDATE OXA-591 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 1314 UPDATE OXA-214 penam; antibiotic inactivation; OXA-214-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-214-like beta-lactamase UPDATED category_aro_cvterm_id with 46496 UPDATED category_aro_accession with 3007707 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-214. " 1312 UPDATE OXA-111 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5752 UPDATE Helicobacter pylori gyrA conferring resistance to fluoroquinolones levofloxacin; antibiotic target alteration; fluoroquinolone antibiotic; fluoroquinolone resistant gyrA; model_param "UPDATED 13165 with D87G UPDATED 13165 with D87G " 5751 UPDATE OXA-290 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 " 4239 UPDATE ADC-171 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4238 UPDATE ADC-170 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4237 UPDATE ADC-169 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4236 UPDATE ADC-168 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4235 UPDATE ADC-167 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4234 UPDATE ADC-166 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4233 UPDATE ADC-165 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4232 UPDATE ADC-164 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4231 UPDATE ADC-163 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4230 UPDATE ADC-162 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 5591 UPDATE PDC-465 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5590 UPDATE PDC-463 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5593 UPDATE PDC-467 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5592 UPDATE PDC-466 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5595 UPDATE PDC-469 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5594 UPDATE PDC-468 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5597 UPDATE PDC-471 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5596 UPDATE PDC-470 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5599 UPDATE PDC-473 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5598 UPDATE PDC-472 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 861 UPDATE OXA-215 penam; antibiotic inactivation; OXA-214-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-214-like beta-lactamase UPDATED category_aro_cvterm_id with 46496 UPDATED category_aro_accession with 3007707 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-214. " 319 UPDATE OXA-366 antibiotic inactivation; penam; OXA-23-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-23-like beta-lactamase UPDATED category_aro_cvterm_id with 46499 UPDATED category_aro_accession with 3007710 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases, specifically imipenem, derived from OXA-23, first identified in Acinetobacter baumannii. " 318 UPDATE OXA-358 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 313 UPDATE OXA-143 OXA-143-like beta-lactamase; antibiotic inactivation; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-143-like beta-lactamase UPDATED category_aro_cvterm_id with 46490 UPDATED category_aro_accession with 3007701 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-143. " 312 UPDATE OXA-167 antibiotic inactivation; penam; OXA-23-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-23-like beta-lactamase UPDATED category_aro_cvterm_id with 46499 UPDATED category_aro_accession with 3007710 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases, specifically imipenem, derived from OXA-23, first identified in Acinetobacter baumannii. " 3944 UPDATE OXA-544 penam; antibiotic inactivation; OXA-2-like beta-lactamase; cephalosporin; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-2-like beta-lactamase UPDATED category_aro_cvterm_id with 46493 UPDATED category_aro_accession with 3007704 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-2. " 867 UPDATE OXA-175 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4129 UPDATE ACT-34 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences "UPDATED fmin with 0 " 4128 UPDATE ACC-8 penam; antibiotic inactivation; cephalosporin; ceftazidime; ACC beta-lactamase; monobactam; model_sequences "UPDATED fmin with 0 " 4123 UPDATE ACC-1a penam; antibiotic inactivation; aztreonam; cephalosporin; cefotaxime; moxalactam; ceftazidime; cefepime; cephamycin; ACC beta-lactamase; monobactam; cefotetan; cefpirome; piperacillin; oxacephem; flomoxef; model_sequences "UPDATED fmin with 0 " 4122 UPDATE AAK-1 carbapenem; antibiotic inactivation; AAK beta-lactamase; model_sequences "UPDATED fmin with 0 " 4127 UPDATE ACC-7 penam; antibiotic inactivation; cephalosporin; ceftazidime; ACC beta-lactamase; monobactam; model_sequences "UPDATED fmin with 0 " 4126 UPDATE ACC-1d penam; antibiotic inactivation; aztreonam; cephalosporin; cefotaxime; moxalactam; ceftazidime; cefepime; cephamycin; ACC beta-lactamase; monobactam; cefotetan; cefpirome; piperacillin; oxacephem; flomoxef; model_sequences "UPDATED fmin with 0 " 4125 UPDATE ACC-1c penam; antibiotic inactivation; aztreonam; cephalosporin; cefotaxime; moxalactam; ceftazidime; cefepime; cephamycin; ACC beta-lactamase; monobactam; cefotetan; cefpirome; piperacillin; oxacephem; flomoxef; model_sequences "UPDATED fmin with 0 " 4124 UPDATE ACC-1b penam; antibiotic inactivation; aztreonam; cephalosporin; cefotaxime; moxalactam; ceftazidime; cefepime; cephamycin; ACC beta-lactamase; monobactam; cefotetan; cefpirome; piperacillin; oxacephem; flomoxef; model_sequences "UPDATED fmin with 0 " 5689 UPDATE VHH-1 antibiotic inactivation; penam; carbapenem; cephalosporin; VHH beta-lactamase; ampicillin; model_sequences "UPDATED fmin with 100 " 5688 UPDATE VEB-27 antibiotic inactivation; monobactam; cephalosporin; VEB beta-lactamase; model_sequences "UPDATED fmin with 0 " 5685 UPDATE VEB-24 antibiotic inactivation; monobactam; cephalosporin; VEB beta-lactamase; model_sequences "UPDATED fmin with 0 " 5684 UPDATE VEB-23 antibiotic inactivation; monobactam; cephalosporin; VEB beta-lactamase; model_sequences "UPDATED fmin with 0 " 5687 UPDATE VEB-26 antibiotic inactivation; monobactam; cephalosporin; VEB beta-lactamase; model_sequences "UPDATED fmin with 0 " 5686 UPDATE VEB-25 antibiotic inactivation; monobactam; cephalosporin; VEB beta-lactamase; model_sequences "UPDATED fmin with 0 " 5681 UPDATE VEB-20 antibiotic inactivation; monobactam; cephalosporin; VEB beta-lactamase; model_sequences "UPDATED fmin with 0 " 5680 UPDATE VEB-19 antibiotic inactivation; monobactam; cephalosporin; VEB beta-lactamase; model_sequences "UPDATED fmin with 0 " 5683 UPDATE VEB-22 antibiotic inactivation; monobactam; cephalosporin; VEB beta-lactamase; model_sequences "UPDATED fmin with 0 " 5682 UPDATE VEB-21 antibiotic inactivation; monobactam; cephalosporin; VEB beta-lactamase; model_sequences "UPDATED fmin with 0 " 4192 UPDATE ADC-119 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4057 UPDATE OXA-573 penam; antibiotic inactivation; OXA-60-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-60-like beta-lactamase UPDATED category_aro_cvterm_id with 46518 UPDATED category_aro_accession with 3007729 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-60. " 4056 UPDATE OXA-570 penam; antibiotic inactivation; OXA-60-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-60-like beta-lactamase UPDATED category_aro_cvterm_id with 46518 UPDATED category_aro_accession with 3007729 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-60. " 4055 UPDATE OXA-926 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 " 4054 UPDATE OXA-835 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; OXA-46-like beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-46-like beta-lactamase UPDATED category_aro_cvterm_id with 46509 UPDATED category_aro_accession with 3007720 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-46. " 4053 UPDATE OXA-541 penam; antibiotic inactivation; OXA-2-like beta-lactamase; cephalosporin; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-2-like beta-lactamase UPDATED category_aro_cvterm_id with 46493 UPDATED category_aro_accession with 3007704 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-2. " 4052 UPDATE OXA-737 penam; antibiotic inactivation; OXA-2-like beta-lactamase; cephalosporin; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-2-like beta-lactamase UPDATED category_aro_cvterm_id with 46493 UPDATED category_aro_accession with 3007704 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-2. " 4051 UPDATE OXA-681 penam; antibiotic inactivation; OXA-2-like beta-lactamase; cephalosporin; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-2-like beta-lactamase UPDATED category_aro_cvterm_id with 46493 UPDATED category_aro_accession with 3007704 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-2. " 4050 UPDATE OXA-543 penam; antibiotic inactivation; OXA-2-like beta-lactamase; cephalosporin; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-2-like beta-lactamase UPDATED category_aro_cvterm_id with 46493 UPDATED category_aro_accession with 3007704 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-2. " 4059 UPDATE OXA-672 penam; antibiotic inactivation; OXA-286-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-286-like beta-lactamase UPDATED category_aro_cvterm_id with 46503 UPDATED category_aro_accession with 3007714 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-286. " 4058 UPDATE OXA-571 penam; antibiotic inactivation; OXA-60-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-60-like beta-lactamase UPDATED category_aro_cvterm_id with 46518 UPDATED category_aro_accession with 3007729 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-60. " 5978 UPDATE OXA-1039 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; meropenem; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 5674 UPDATE VEB-11 antibiotic inactivation; monobactam; cephalosporin; VEB beta-lactamase; model_sequences "UPDATED fmin with 0 " 5977 UPDATE OXA-1038 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; meropenem; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 4359 UPDATE ALG6-1 carbapenem; antibiotic inactivation; ALG6 beta-lactamases; model_sequences "UPDATED fmin with 0 " 4354 UPDATE ADC-98 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 5679 UPDATE VEB-17 antibiotic inactivation; monobactam; cephalosporin; VEB beta-lactamase; model_sequences "UPDATED fmin with 0 " 5029 UPDATE OXA-717 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 12 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5028 UPDATE OXA-716 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 12 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5021 UPDATE OXA-709 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 11 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 865 UPDATE OXA-244 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 5023 UPDATE OXA-711 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 21 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5022 UPDATE OXA-710 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 21 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5025 UPDATE OXA-713 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 14 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5024 UPDATE OXA-712 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 28 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5027 UPDATE OXA-715 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 13 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5026 UPDATE OXA-714 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 21 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4440 UPDATE CDD-1 carbapenem; antibiotic inactivation; CDD beta-lactamase; model_sequences "UPDATED fmin with 100 " 1860 UPDATE OXA-165 antibiotic inactivation; penam; OXA-23-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-23-like beta-lactamase UPDATED category_aro_cvterm_id with 46499 UPDATED category_aro_accession with 3007710 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases, specifically imipenem, derived from OXA-23, first identified in Acinetobacter baumannii. " 4442 UPDATE CepA-29 CepA beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 1862 UPDATE OXA-109 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4444 UPDATE CepA-49 CepA beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 4445 UPDATE CfiA10 carbapenem; antibiotic inactivation; CfiA beta-lactamase; model_sequences "UPDATED fmin with 0 " 4446 UPDATE CfiA11 carbapenem; antibiotic inactivation; CfiA beta-lactamase; model_sequences "UPDATED fmin with 100 " 4447 UPDATE CfiA14 carbapenem; antibiotic inactivation; CfiA beta-lactamase; model_sequences "UPDATED fmin with 100 " 4448 UPDATE CfiA17 carbapenem; antibiotic inactivation; CfiA beta-lactamase; model_sequences "UPDATED fmin with 0 " 4449 UPDATE CfiA18 carbapenem; antibiotic inactivation; CfiA beta-lactamase; model_sequences "UPDATED fmin with 0 " 4686 UPDATE IMP-59 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 0 " 4687 UPDATE IMP-60 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 0 " 4684 UPDATE IMP-54 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 0 " 4685 UPDATE IMP-58 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 0 " 4682 UPDATE IMP-46 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 0 " 4683 UPDATE IMP-53 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 100 " 4680 UPDATE IMP-23 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 0 " 4681 UPDATE IMP-39 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 0 " 4938 UPDATE OXA-612 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 4939 UPDATE OXA-613 penam; OXA-184-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-184-like beta-lactamase UPDATED category_aro_cvterm_id with 46491 UPDATED category_aro_accession with 3007702 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-184. " 4688 UPDATE IMP-61 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 0 " 4689 UPDATE IMP-62 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 0 " 2100 UPDATE Mycobacteroides chelonae 16S rRNA mutation conferring resistance to amikacin antibiotic target alteration; amikacin; aminoglycoside antibiotic; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; model_sequences "UPDATED fmin with 0 " 2105 UPDATE Mycobacteroides abscessus 16S rRNA mutation conferring resistance to neomycin antibiotic target alteration; aminoglycoside antibiotic; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; neomycin; model_sequences "UPDATED fmin with 1462397 " 5115 UPDATE OXA-810 antibiotic inactivation; penam; OXA-23-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-23-like beta-lactamase UPDATED category_aro_cvterm_id with 46499 UPDATED category_aro_accession with 3007710 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases, specifically imipenem, derived from OXA-23, first identified in Acinetobacter baumannii. " 5114 UPDATE OXA-809 antibiotic inactivation; penam; OXA-23-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-23-like beta-lactamase UPDATED category_aro_cvterm_id with 46499 UPDATED category_aro_accession with 3007710 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases, specifically imipenem, derived from OXA-23, first identified in Acinetobacter baumannii. " 5117 UPDATE OXA-813 antibiotic inactivation; penam; OXA-23-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 100 DELETED 35930 UPDATED category_aro_name with OXA-23-like beta-lactamase UPDATED category_aro_cvterm_id with 46499 UPDATED category_aro_accession with 3007710 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases, specifically imipenem, derived from OXA-23, first identified in Acinetobacter baumannii. " 5116 UPDATE OXA-811 antibiotic inactivation; penam; OXA-23-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-23-like beta-lactamase UPDATED category_aro_cvterm_id with 46499 UPDATED category_aro_accession with 3007710 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases, specifically imipenem, derived from OXA-23, first identified in Acinetobacter baumannii. " 5111 UPDATE OXA-806 antibiotic inactivation; penam; OXA-23-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-23-like beta-lactamase UPDATED category_aro_cvterm_id with 46499 UPDATED category_aro_accession with 3007710 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases, specifically imipenem, derived from OXA-23, first identified in Acinetobacter baumannii. " 5110 UPDATE OXA-805 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 5113 UPDATE OXA-808 antibiotic inactivation; penam; OXA-23-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-23-like beta-lactamase UPDATED category_aro_cvterm_id with 46499 UPDATED category_aro_accession with 3007710 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases, specifically imipenem, derived from OXA-23, first identified in Acinetobacter baumannii. " 5112 UPDATE OXA-807 antibiotic inactivation; penam; OXA-23-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-23-like beta-lactamase UPDATED category_aro_cvterm_id with 46499 UPDATED category_aro_accession with 3007710 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases, specifically imipenem, derived from OXA-23, first identified in Acinetobacter baumannii. " 5119 UPDATE OXA-815 antibiotic inactivation; penam; OXA-23-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-23-like beta-lactamase UPDATED category_aro_cvterm_id with 46499 UPDATED category_aro_accession with 3007710 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases, specifically imipenem, derived from OXA-23, first identified in Acinetobacter baumannii. " 5118 UPDATE OXA-814 antibiotic inactivation; penam; OXA-23-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-23-like beta-lactamase UPDATED category_aro_cvterm_id with 46499 UPDATED category_aro_accession with 3007710 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases, specifically imipenem, derived from OXA-23, first identified in Acinetobacter baumannii. " 3438 UPDATE OXA-271 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 3439 UPDATE OXA-272 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 4936 UPDATE OXA-610 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 3430 UPDATE OXA-263 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 3431 UPDATE OXA-264 penam; antibiotic inactivation; OXA-214-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-214-like beta-lactamase UPDATED category_aro_cvterm_id with 46496 UPDATED category_aro_accession with 3007707 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-214. " 3432 UPDATE OXA-265 penam; antibiotic inactivation; OXA-214-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-214-like beta-lactamase UPDATED category_aro_cvterm_id with 46496 UPDATED category_aro_accession with 3007707 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-214. " 3433 UPDATE OXA-266 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; OXA-266-like beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-266-like beta-lactamase UPDATED category_aro_cvterm_id with 46501 UPDATED category_aro_accession with 3007712 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-266. " 3434 UPDATE OXA-267 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 3435 UPDATE OXA-268 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 3436 UPDATE OXA-269 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 3437 UPDATE OXA-270 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 4592 UPDATE EC-18 EC beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 4593 UPDATE EC-19 EC beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 4590 UPDATE EC-15 EC beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 4591 UPDATE EC-16 EC beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 4596 UPDATE ECM-1 carbapenem; ECM beta-lactamase; antibiotic inactivation; model_sequences "UPDATED fmin with 18 " 4849 UPDATE OXA-514 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 2031 UPDATE OXA-173 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4595 UPDATE EC-8 EC beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 4844 UPDATE OXA-509 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4845 UPDATE OXA-510 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4846 UPDATE OXA-511 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4847 UPDATE OXA-512 penam; antibiotic inactivation; OXA-58-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-58-like beta-lactamase UPDATED category_aro_cvterm_id with 46517 UPDATED category_aro_accession with 3007728 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-58. " 4840 UPDATE OXA-505 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 4841 UPDATE OXA-506 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 4842 UPDATE OXA-507 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4843 UPDATE OXA-508 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4937 UPDATE OXA-611 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 897 UPDATE OXA-383 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 899 UPDATE OXA-94 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 646 UPDATE OXA-349 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 1715 UPDATE OXA-73 antibiotic inactivation; penam; OXA-23-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-23-like beta-lactamase UPDATED category_aro_cvterm_id with 46499 UPDATED category_aro_accession with 3007710 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases, specifically imipenem, derived from OXA-23, first identified in Acinetobacter baumannii. " 5201 UPDATE OXA-909 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 100 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5200 UPDATE OXA-908 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; OXA-50-like beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-50-like beta-lactamase UPDATED category_aro_cvterm_id with 46513 UPDATED category_aro_accession with 3007724 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-50. " 5203 UPDATE OXA-911 antibiotic inactivation; penam; OXA-23-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-23-like beta-lactamase UPDATED category_aro_cvterm_id with 46499 UPDATED category_aro_accession with 3007710 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases, specifically imipenem, derived from OXA-23, first identified in Acinetobacter baumannii. " 5202 UPDATE OXA-910 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 100 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5205 UPDATE OXA-913 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; OXA-50-like beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-50-like beta-lactamase UPDATED category_aro_cvterm_id with 46513 UPDATED category_aro_accession with 3007724 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-50. " 5204 UPDATE OXA-912 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; OXA-12-like beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-12-like beta-lactamase UPDATED category_aro_cvterm_id with 46488 UPDATED category_aro_accession with 3007699 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-12. " 5207 UPDATE OXA-916 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5206 UPDATE OXA-914 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; OXA-50-like beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-50-like beta-lactamase UPDATED category_aro_cvterm_id with 46513 UPDATED category_aro_accession with 3007724 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-50. " 5209 UPDATE OXA-918 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 5208 UPDATE OXA-917 penam; antibiotic inactivation; OXA-427-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-427-like beta-lactamase UPDATED category_aro_cvterm_id with 46508 UPDATED category_aro_accession with 3007719 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-427. " 3544 UPDATE OXA-483 antibiotic inactivation; penam; OXA-23-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-23-like beta-lactamase UPDATED category_aro_cvterm_id with 46499 UPDATED category_aro_accession with 3007710 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases, specifically imipenem, derived from OXA-23, first identified in Acinetobacter baumannii. " 3545 UPDATE OXA-484 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 3546 UPDATE OXA-485 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; OXA-50-like beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-50-like beta-lactamase UPDATED category_aro_cvterm_id with 46513 UPDATED category_aro_accession with 3007724 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-50. " 3547 UPDATE OXA-486 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; OXA-50-like beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-50-like beta-lactamase UPDATED category_aro_cvterm_id with 46513 UPDATED category_aro_accession with 3007724 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-50. " 3540 UPDATE OXA-478 penam; antibiotic inactivation; OXA beta-lactamase; OXA-63-like beta-lactamase; oxacillin; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-63-like beta-lactamase UPDATED category_aro_cvterm_id with 46521 UPDATED category_aro_accession with 3007732 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-63. " 3541 UPDATE OXA-479 penam; antibiotic inactivation; OXA beta-lactamase; OXA-63-like beta-lactamase; oxacillin; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-63-like beta-lactamase UPDATED category_aro_cvterm_id with 46521 UPDATED category_aro_accession with 3007732 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-63. " 3542 UPDATE OXA-480 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 3543 UPDATE OXA-482 antibiotic inactivation; penam; OXA-23-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-23-like beta-lactamase UPDATED category_aro_cvterm_id with 46499 UPDATED category_aro_accession with 3007710 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases, specifically imipenem, derived from OXA-23, first identified in Acinetobacter baumannii. " 3548 UPDATE OXA-488 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; OXA-50-like beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-50-like beta-lactamase UPDATED category_aro_cvterm_id with 46513 UPDATED category_aro_accession with 3007724 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-50. " 5196 UPDATE OXA-903 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; OXA-50-like beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-50-like beta-lactamase UPDATED category_aro_cvterm_id with 46513 UPDATED category_aro_accession with 3007724 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-50. " 2960 UPDATE OXA-663 penam; OXA-10-like beta-lactamase; cephalosporin; antibiotic inactivation; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-10-like beta-lactamase UPDATED category_aro_cvterm_id with 46486 UPDATED category_aro_accession with 3007697 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-10. " 1780 UPDATE OXA-146 antibiotic inactivation; penam; OXA-23-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-23-like beta-lactamase UPDATED category_aro_cvterm_id with 46499 UPDATED category_aro_accession with 3007710 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases, specifically imipenem, derived from OXA-23, first identified in Acinetobacter baumannii. " 1784 UPDATE OXA-334 antibiotic inactivation; penam; OXA-211-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-211-like beta-lactamase UPDATED category_aro_cvterm_id with 46494 UPDATED category_aro_accession with 3007705 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-211. " 767 UPDATE OXA-207 penam; antibiotic inactivation; OXA-24-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-24-like beta-lactamase UPDATED category_aro_cvterm_id with 46500 UPDATED category_aro_accession with 3007711 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-24. " 5193 UPDATE OXA-900 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 " 5379 UPDATE PDC-241 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5378 UPDATE PDC-24 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 1079 UPDATE OXA-161 penam; antibiotic inactivation; OXA-2-like beta-lactamase; cephalosporin; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-2-like beta-lactamase UPDATED category_aro_cvterm_id with 46493 UPDATED category_aro_accession with 3007704 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-2. " 5375 UPDATE PDC-237 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5374 UPDATE PDC-236 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5377 UPDATE PDC-239 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5376 UPDATE PDC-238 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5371 UPDATE PDC-233 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5370 UPDATE PDC-232 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5373 UPDATE PDC-235 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5372 UPDATE PDC-234 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 1679 UPDATE OXA-49 antibiotic inactivation; penam; OXA-23-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-23-like beta-lactamase UPDATED category_aro_cvterm_id with 46499 UPDATED category_aro_accession with 3007710 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases, specifically imipenem, derived from OXA-23, first identified in Acinetobacter baumannii. " 4338 UPDATE ADC-80 antibiotic inactivation; cephalosporin; ADC beta-lactamase without carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4339 UPDATE ADC-83 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4336 UPDATE ADC-66 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4337 UPDATE ADC-70 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4334 UPDATE ADC-63 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4335 UPDATE ADC-65 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4332 UPDATE ADC-54 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4333 UPDATE ADC-57 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4330 UPDATE ADC-52 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4331 UPDATE ADC-53 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 1419 UPDATE OXA-454 penam; OXA-10-like beta-lactamase; cephalosporin; antibiotic inactivation; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-10-like beta-lactamase UPDATED category_aro_cvterm_id with 46486 UPDATED category_aro_accession with 3007697 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-10. " 1410 UPDATE OXA-19 penam; OXA-10-like beta-lactamase; cephalosporin; antibiotic inactivation; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-10-like beta-lactamase UPDATED category_aro_cvterm_id with 46486 UPDATED category_aro_accession with 3007697 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-10. " 1411 UPDATE OXA-62 antibiotic inactivation; penam; OXA-62-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-62-like beta-lactamase UPDATED category_aro_cvterm_id with 46520 UPDATED category_aro_accession with 3007731 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-62. " 1413 UPDATE OXA-172 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 1416 UPDATE OXA-89 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 1417 UPDATE OXA-131 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 1326 UPDATE OXA-170 antibiotic inactivation; penam; OXA-23-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-23-like beta-lactamase UPDATED category_aro_cvterm_id with 46499 UPDATED category_aro_accession with 3007710 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases, specifically imipenem, derived from OXA-23, first identified in Acinetobacter baumannii. " 1325 UPDATE OXA-65 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4647 UPDATE GOB-34 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 4208 UPDATE ADC-137 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4209 UPDATE ADC-138 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4202 UPDATE ADC-131 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4203 UPDATE ADC-132 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4200 UPDATE ADC-129 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4201 UPDATE ADC-130 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4206 UPDATE ADC-135 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4207 UPDATE ADC-136 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4204 UPDATE ADC-133 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4205 UPDATE ADC-134 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 5568 UPDATE PDC-440 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5569 UPDATE PDC-441 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5564 UPDATE PDC-435 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5565 UPDATE PDC-436 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5566 UPDATE PDC-437 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5567 UPDATE PDC-439 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5560 UPDATE PDC-431 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5561 UPDATE PDC-432 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5562 UPDATE PDC-433 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5563 UPDATE PDC-434 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 1255 UPDATE OXA-119 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; OXA-46-like beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-46-like beta-lactamase UPDATED category_aro_cvterm_id with 46509 UPDATED category_aro_accession with 3007720 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-46. " 1258 UPDATE OXA-55 penam; antibiotic inactivation; OXA-55-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-55-like beta-lactamase UPDATED category_aro_cvterm_id with 46516 UPDATED category_aro_accession with 3007727 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapanem-hydrolyzing class D OXA beta-lactamases derived from OXA-55. " 5184 UPDATE OXA-887 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 12 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5012 UPDATE OXA-700 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 12 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5013 UPDATE OXA-701 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 17 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4062 UPDATE OXA-931 antibiotic inactivation; penam; OXA-229-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-229-like beta-lactamase UPDATED category_aro_cvterm_id with 46498 UPDATED category_aro_accession with 3007709 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-229. " 4063 UPDATE OXA-930 antibiotic inactivation; penam; OXA-229-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-229-like beta-lactamase UPDATED category_aro_cvterm_id with 46498 UPDATED category_aro_accession with 3007709 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-229. " 4060 UPDATE OXA-671 penam; antibiotic inactivation; OXA-286-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-286-like beta-lactamase UPDATED category_aro_cvterm_id with 46503 UPDATED category_aro_accession with 3007714 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-286. " 4061 UPDATE OXA-673 penam; antibiotic inactivation; OXA-286-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-286-like beta-lactamase UPDATED category_aro_cvterm_id with 46503 UPDATED category_aro_accession with 3007714 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-286. " 4067 UPDATE OXA-496 penam; antibiotic inactivation; OXA-134-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-134-like beta-lactamase UPDATED category_aro_cvterm_id with 46489 UPDATED category_aro_accession with 3007700 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-134. " 4064 UPDATE OXA-895 antibiotic inactivation; penam; OXA-229-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-229-like beta-lactamase UPDATED category_aro_cvterm_id with 46498 UPDATED category_aro_accession with 3007709 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-229. " 4065 UPDATE OXA-641 OXA-372-like beta-lactamase; antibiotic inactivation; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-372-like beta-lactamase UPDATED category_aro_cvterm_id with 46506 UPDATED category_aro_accession with 3007717 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-372. " 4068 UPDATE OXA-915 penam; antibiotic inactivation; OXA-134-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-134-like beta-lactamase UPDATED category_aro_cvterm_id with 46489 UPDATED category_aro_accession with 3007700 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-134. " 4069 UPDATE OXA-647 penam; antibiotic inactivation; OXA-134-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-134-like beta-lactamase UPDATED category_aro_cvterm_id with 46489 UPDATED category_aro_accession with 3007700 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-134. " 5018 UPDATE OXA-706 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 17 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5019 UPDATE OXA-707 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 24 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 981 UPDATE OXA-86 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 1040 UPDATE OXA-95 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4453 UPDATE CfiA22 carbapenem; antibiotic inactivation; CfiA beta-lactamase; model_sequences "UPDATED fmin with 0 " 4452 UPDATE CfiA21 carbapenem; antibiotic inactivation; CfiA beta-lactamase; model_sequences "UPDATED fmin with 0 " 4451 UPDATE CfiA2 carbapenem; antibiotic inactivation; CfiA beta-lactamase; model_sequences "UPDATED fmin with 0 " 4450 UPDATE CfiA19 carbapenem; antibiotic inactivation; CfiA beta-lactamase; model_sequences "UPDATED fmin with 0 " 4457 UPDATE CfiA27 carbapenem; antibiotic inactivation; CfiA beta-lactamase; model_sequences "UPDATED fmin with 0 " 4456 UPDATE CfiA26 carbapenem; antibiotic inactivation; CfiA beta-lactamase; model_sequences "UPDATED fmin with 0 " 4455 UPDATE CfiA24 carbapenem; antibiotic inactivation; CfiA beta-lactamase; model_sequences "UPDATED fmin with 0 " 4454 UPDATE CfiA23 carbapenem; antibiotic inactivation; CfiA beta-lactamase; model_sequences "UPDATED fmin with 0 " 4459 UPDATE CfiA8 carbapenem; antibiotic inactivation; CfiA beta-lactamase; model_sequences "UPDATED fmin with 0 " 4458 UPDATE CfiA4 carbapenem; antibiotic inactivation; CfiA beta-lactamase; model_sequences "UPDATED fmin with 0 " 1892 UPDATE OXA-114a OXA-114-like beta-lactamase; penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-114-like beta-lactamase UPDATED category_aro_cvterm_id with 46487 UPDATED category_aro_accession with 3007698 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-114. " 4923 UPDATE OXA-597 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 4922 UPDATE OXA-596 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 4921 UPDATE OXA-595 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 4920 UPDATE OXA-594 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 4927 UPDATE OXA-601 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 4926 UPDATE OXA-600 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 4697 UPDATE IMP-71 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 0 " 4696 UPDATE IMP-70 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 0 " 4699 UPDATE IMP-74 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 0 " 4698 UPDATE IMP-73 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 0 " 4929 UPDATE OXA-603 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 4928 UPDATE OXA-602 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 5160 UPDATE OXA-863 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 14 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5161 UPDATE OXA-864 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 13 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5162 UPDATE OXA-865 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 42 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5163 UPDATE OXA-866 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 30 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5164 UPDATE OXA-867 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 47 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5165 UPDATE OXA-868 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 23 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5166 UPDATE OXA-869 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 34 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5167 UPDATE OXA-870 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 34 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5168 UPDATE OXA-871 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 34 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5169 UPDATE OXA-872 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 34 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4941 UPDATE OXA-615 penam; OXA-184-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-184-like beta-lactamase UPDATED category_aro_cvterm_id with 46491 UPDATED category_aro_accession with 3007702 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-184. " 3429 UPDATE OXA-262 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 3428 UPDATE OXA-261 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 3423 UPDATE OXA-185 penam; OXA-184-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-184-like beta-lactamase UPDATED category_aro_cvterm_id with 46491 UPDATED category_aro_accession with 3007702 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-184. " 3422 UPDATE OXA-158 antibiotic inactivation; penam; OXA-62-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-62-like beta-lactamase UPDATED category_aro_cvterm_id with 46520 UPDATED category_aro_accession with 3007731 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-62. " 3421 UPDATE OXA-157 antibiotic inactivation; penam; OXA-62-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-62-like beta-lactamase UPDATED category_aro_cvterm_id with 46520 UPDATED category_aro_accession with 3007731 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-62. " 3420 UPDATE OXA-156 antibiotic inactivation; penam; OXA-62-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-62-like beta-lactamase UPDATED category_aro_cvterm_id with 46520 UPDATED category_aro_accession with 3007731 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-62. " 3427 UPDATE OXA-260 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 3426 UPDATE OXA-259 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 3425 UPDATE OXA-252 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 3424 UPDATE OXA-234 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 2001 UPDATE OXA-250 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4589 UPDATE EC-14 EC beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 4588 UPDATE EC-13 EC beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 4859 UPDATE OXA-524 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4858 UPDATE OXA-523 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4585 UPDATE EAM-1 carbapenem; antibiotic inactivation; EAM beta-lactamase; model_sequences "UPDATED fmin with 0 " 4856 UPDATE OXA-521 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4587 UPDATE EBR-4 carbapenem; penam; cephalosporin; EBR beta-lactamase; antibiotic inactivation; model_sequences "UPDATED fmin with 0 " 4586 UPDATE EBR-3 carbapenem; penam; cephalosporin; EBR beta-lactamase; antibiotic inactivation; model_sequences "UPDATED fmin with 0 " 4853 UPDATE OXA-518 penam; OXA-493-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-493-like beta-lactamase UPDATED category_aro_cvterm_id with 46511 UPDATED category_aro_accession with 3007722 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-493. " 4580 UPDATE DHA-27 antibiotic inactivation; cephalosporin; cephamycin; DHA beta-lactamase; model_sequences "UPDATED fmin with 0 " 4851 UPDATE OXA-516 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4850 UPDATE OXA-515 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 4414 UPDATE CARB-28 penam; antibiotic inactivation; CARB beta-lactamase; model_sequences "UPDATED fmin with 0 " 4301 UPDATE ADC-236 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 2910 UPDATE OXA-665 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 " 2912 UPDATE OXA-274 antibiotic inactivation; penam; OXA-274-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-274-like beta-lactamase UPDATED category_aro_cvterm_id with 46502 UPDATED category_aro_accession with 3007713 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-274. " 2913 UPDATE OXA-286 penam; antibiotic inactivation; OXA-286-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-286-like beta-lactamase UPDATED category_aro_cvterm_id with 46503 UPDATED category_aro_accession with 3007714 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-286. " 5308 UPDATE PDC-169 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5309 UPDATE PDC-17 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 4964 UPDATE OXA-638 penam; OXA-184-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-184-like beta-lactamase UPDATED category_aro_cvterm_id with 46491 UPDATED category_aro_accession with 3007702 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-184. " 5300 UPDATE PDC-161 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5301 UPDATE PDC-162 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5302 UPDATE PDC-163 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5303 UPDATE PDC-164 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5304 UPDATE PDC-165 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5305 UPDATE PDC-166 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5306 UPDATE PDC-167 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5307 UPDATE PDC-168 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 1660 UPDATE OXA-375 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4329 UPDATE ADC-51 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 1083 UPDATE OXA-323 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 4321 UPDATE ADC-255 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4320 UPDATE ADC-254 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4322 UPDATE ADC-256 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4325 UPDATE ADC-32 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4324 UPDATE ADC-29 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4327 UPDATE ADC-38 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4326 UPDATE ADC-33 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 5414 UPDATE PDC-280 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5415 UPDATE PDC-281 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5416 UPDATE PDC-282 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5417 UPDATE PDC-283 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5410 UPDATE PDC-276 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5411 UPDATE PDC-277 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5412 UPDATE PDC-278 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5413 UPDATE PDC-279 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5418 UPDATE PDC-286 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5419 UPDATE PDC-287 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 1403 UPDATE OXA-388 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 1402 UPDATE OXA-390 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4437 UPDATE CARB-53 penam; antibiotic inactivation; CARB beta-lactamase; model_sequences "UPDATED fmin with 0 " 1406 UPDATE OXA-121 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4215 UPDATE ADC-145 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 8 " 4214 UPDATE ADC-144 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4217 UPDATE ADC-147 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 84 " 4216 UPDATE ADC-146 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 65 " 4211 UPDATE ADC-140 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4210 UPDATE ADC-139 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4213 UPDATE ADC-143 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4212 UPDATE ADC-141 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 441 UPDATE OXA-54 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 4219 UPDATE ADC-149 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4218 UPDATE ADC-148 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4425 UPDATE CARB-41 penam; antibiotic inactivation; CARB beta-lactamase; model_sequences "UPDATED fmin with 0 " 5579 UPDATE PDC-452 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5578 UPDATE PDC-451 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5577 UPDATE PDC-450 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5576 UPDATE PDC-448 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5575 UPDATE PDC-447 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5574 UPDATE PDC-446 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5573 UPDATE PDC-445 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5572 UPDATE PDC-444 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5571 UPDATE PDC-443 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5570 UPDATE PDC-442 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 1536 UPDATE OXA-421 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 1532 UPDATE OXA-249 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 1530 UPDATE OXA-67 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 649 UPDATE OXA-115 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5128 UPDATE OXA-826 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 4075 UPDATE OXA-499 OXA-143-like beta-lactamase; antibiotic inactivation; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-143-like beta-lactamase UPDATED category_aro_cvterm_id with 46490 UPDATED category_aro_accession with 3007701 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-143. " 4074 UPDATE OXA-653 penam; antibiotic inactivation; OXA-24-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-24-like beta-lactamase UPDATED category_aro_cvterm_id with 46500 UPDATED category_aro_accession with 3007711 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-24. " 4076 UPDATE OXA-825 OXA-143-like beta-lactamase; antibiotic inactivation; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-143-like beta-lactamase UPDATED category_aro_cvterm_id with 46490 UPDATED category_aro_accession with 3007701 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-143. " 4071 UPDATE OXA-646 penam; antibiotic inactivation; OXA-134-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-134-like beta-lactamase UPDATED category_aro_cvterm_id with 46489 UPDATED category_aro_accession with 3007700 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-134. " 4070 UPDATE OXA-648 penam; antibiotic inactivation; OXA-134-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-134-like beta-lactamase UPDATED category_aro_cvterm_id with 46489 UPDATED category_aro_accession with 3007700 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-134. " 4073 UPDATE OXA-897 penam; antibiotic inactivation; OXA-24-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-24-like beta-lactamase UPDATED category_aro_cvterm_id with 46500 UPDATED category_aro_accession with 3007711 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-24. " 4072 UPDATE OXA-649 OXA-143-like beta-lactamase; antibiotic inactivation; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-143-like beta-lactamase UPDATED category_aro_cvterm_id with 46490 UPDATED category_aro_accession with 3007701 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-143. " 3500 UPDATE OXA-417 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 3501 UPDATE OXA-427 penam; antibiotic inactivation; OXA-427-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-427-like beta-lactamase UPDATED category_aro_cvterm_id with 46508 UPDATED category_aro_accession with 3007719 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-427. " 1962 UPDATE OXA-47 penam; antibiotic inactivation; OXA-1-like beta-lactamase; cephalosporin; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-1-like beta-lactamase UPDATED category_aro_cvterm_id with 46485 UPDATED category_aro_accession with 3007696 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-1. " 3502 UPDATE OXA-429 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 3503 UPDATE OXA-430 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 3504 UPDATE OXA-431 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 3633 UPDATE OXA-724 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; OXA-12-like beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-12-like beta-lactamase UPDATED category_aro_cvterm_id with 46488 UPDATED category_aro_accession with 3007699 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-12. " 5086 UPDATE OXA-777 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 3506 UPDATE OXA-433 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4610 UPDATE GES-27 carbapenem; penam; cephalosporin; antibiotic inactivation; GES beta-lactamase; model_sequences "UPDATED fmin with 0 " 3507 UPDATE OXA-437 penam; antibiotic inactivation; OXA-24-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-24-like beta-lactamase UPDATED category_aro_cvterm_id with 46500 UPDATED category_aro_accession with 3007711 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-24. " 4615 UPDATE GES-32 carbapenem; penam; cephalosporin; antibiotic inactivation; GES beta-lactamase; model_sequences "UPDATED fmin with 0 " 4614 UPDATE GES-31 carbapenem; penam; cephalosporin; antibiotic inactivation; GES beta-lactamase; model_sequences "UPDATED fmin with 0 " 4468 UPDATE CMH-6 antibiotic inactivation; CMH beta-lactamase; cephalosporin; model_sequences "UPDATED fmin with 0 " 4469 UPDATE CMY-106 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 100 " 4466 UPDATE CMH-4 antibiotic inactivation; CMH beta-lactamase; cephalosporin; model_sequences "UPDATED fmin with 0 " 4467 UPDATE CMH-5 antibiotic inactivation; CMH beta-lactamase; cephalosporin; model_sequences "UPDATED fmin with 0 " 4464 UPDATE CMH-2 antibiotic inactivation; CMH beta-lactamase; cephalosporin; model_sequences "UPDATED fmin with 0 " 4465 UPDATE CMH-3 antibiotic inactivation; CMH beta-lactamase; cephalosporin; model_sequences "UPDATED fmin with 0 " 4462 UPDATE CMA-2 antibiotic inactivation; cephalosporin; CMA beta-lactamase; model_sequences "UPDATED fmin with 100 " 4463 UPDATE CME-2 penam; antibiotic inactivation; CME beta-lactamase; model_sequences "UPDATED fmin with 0 " 4460 UPDATE CfiA9 carbapenem; antibiotic inactivation; CfiA beta-lactamase; model_sequences "UPDATED fmin with 0 " 4461 UPDATE CMA-1 antibiotic inactivation; cephalosporin; CMA beta-lactamase; model_sequences "UPDATED fmin with 100 " 2122 UPDATE Mycobacteroides chelonae 16S rRNA mutation conferring resistance to neomycin antibiotic target alteration; aminoglycoside antibiotic; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; neomycin; model_sequences "UPDATED fmin with 0 " 4668 UPDATE IMI-14 carbapenem; antibiotic inactivation; IMI beta-lactamase; model_sequences "UPDATED fmin with 0 " 4669 UPDATE IMI-15 carbapenem; antibiotic inactivation; IMI beta-lactamase; model_sequences "UPDATED fmin with 0 " 4918 UPDATE OXA-592 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 4919 UPDATE OXA-593 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 4916 UPDATE OXA-590 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 4665 UPDATE GRD33-1 carbapenem; antibiotic inactivation; GRD33 beta-lactamase; model_sequences "UPDATED fmin with 0 " 4914 UPDATE OXA-588 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 4915 UPDATE OXA-589 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 4660 UPDATE GOB-48 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 4661 UPDATE GOB-49 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 4910 UPDATE OXA-584 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 4911 UPDATE OXA-585 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 5173 UPDATE OXA-876 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 40 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5172 UPDATE OXA-875 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 42 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5171 UPDATE OXA-874 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 40 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5170 UPDATE OXA-873 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 16 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5177 UPDATE OXA-880 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 39 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5176 UPDATE OXA-879 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 44 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5175 UPDATE OXA-878 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 40 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5174 UPDATE OXA-877 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 35 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5179 UPDATE OXA-882 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 29 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5178 UPDATE OXA-881 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 27 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 3416 UPDATE OXA-152 antibiotic inactivation; penam; OXA-62-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-62-like beta-lactamase UPDATED category_aro_cvterm_id with 46520 UPDATED category_aro_accession with 3007731 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-62. " 3417 UPDATE OXA-153 antibiotic inactivation; penam; OXA-62-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-62-like beta-lactamase UPDATED category_aro_cvterm_id with 46520 UPDATED category_aro_accession with 3007731 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-62. " 3415 UPDATE OXA-151 antibiotic inactivation; penam; OXA-62-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-62-like beta-lactamase UPDATED category_aro_cvterm_id with 46520 UPDATED category_aro_accession with 3007731 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-62. " 3412 UPDATE OXA-126 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 3413 UPDATE OXA-127 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 3410 UPDATE OXA-124 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 3411 UPDATE OXA-125 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 3418 UPDATE OXA-154 antibiotic inactivation; penam; OXA-62-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-62-like beta-lactamase UPDATED category_aro_cvterm_id with 46520 UPDATED category_aro_accession with 3007731 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-62. " 3419 UPDATE OXA-155 antibiotic inactivation; penam; OXA-62-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-62-like beta-lactamase UPDATED category_aro_cvterm_id with 46520 UPDATED category_aro_accession with 3007731 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-62. " 4868 UPDATE OXA-533 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 4869 UPDATE OXA-534 penam; antibiotic inactivation; OXA-1-like beta-lactamase; cephalosporin; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-1-like beta-lactamase UPDATED category_aro_cvterm_id with 46485 UPDATED category_aro_accession with 3007696 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-1. " 2019 UPDATE OXA-213 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 4862 UPDATE OXA-527 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 " 4863 UPDATE OXA-528 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4860 UPDATE OXA-525 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 2016 UPDATE OXA-370 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 4866 UPDATE OXA-531 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4867 UPDATE OXA-532 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4864 UPDATE OXA-529 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4865 UPDATE OXA-530 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4377 UPDATE BlaB-16 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences "UPDATED fmin with 0 " 2129 UPDATE Escherichia coli 16S rRNA (rrsB) mutation conferring resistance to spectinomycin antibiotic target alteration; aminoglycoside antibiotic; spectinomycin; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; model_sequences "UPDATED fmin with 4166658 " 4484 UPDATE CRP-1 carbapenem; antibiotic inactivation; CRP beta-lactamase; model_sequences "UPDATED fmin with 100 " 4485 UPDATE CSA-1 antibiotic inactivation; cephalosporin; CSA beta-lactamase; model_sequences "UPDATED fmin with 100 " 4486 UPDATE CSA-2 antibiotic inactivation; cephalosporin; CSA beta-lactamase; model_sequences "UPDATED fmin with 100 " 4487 UPDATE CSP-1 antibiotic inactivation; cephalosporin; CSP beta-lactamase; model_sequences "UPDATED fmin with 100 " 4480 UPDATE CRD3-1 carbapenem; antibiotic inactivation; CRD3 beta-lactamase; model_sequences "UPDATED fmin with 0 " 4481 UPDATE CRH-1 carbapenem; antibiotic inactivation; CRH beta-lactamase; model_sequences "UPDATED fmin with 100 " 4482 UPDATE CRH-2 carbapenem; antibiotic inactivation; CRH beta-lactamase; model_sequences "UPDATED fmin with 0 " 4483 UPDATE CRH-3 carbapenem; antibiotic inactivation; CRH beta-lactamase; model_sequences "UPDATED fmin with 0 " 4488 UPDATE CTX-M-127 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4489 UPDATE CTX-M-138 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 2909 UPDATE OXA-664 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 " 89 UPDATE vanY gene in vanA cluster glycopeptide resistance gene cluster; teicoplanin; vanY; glycopeptide antibiotic; antibiotic target alteration; vancomycin; model_sequences "UPDATED fmin with 9051 " 4793 UPDATE OKP-C-1 penam; antibiotic inactivation; OKP beta-lactamase; cephalosporin; model_sequences "UPDATED fmin with 0 " 5319 UPDATE PDC-18 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5318 UPDATE PDC-179 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5313 UPDATE PDC-174 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 100 " 5312 UPDATE PDC-172 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5311 UPDATE PDC-171 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5310 UPDATE PDC-170 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5317 UPDATE PDC-178 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5316 UPDATE PDC-177 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5315 UPDATE PDC-176 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5314 UPDATE PDC-175 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 1659 UPDATE OXA-258 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 " 413 UPDATE OXA-144 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5407 UPDATE PDC-273 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5406 UPDATE PDC-271 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5405 UPDATE PDC-270 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5404 UPDATE PDC-268 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5403 UPDATE PDC-267 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5402 UPDATE PDC-266 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5401 UPDATE PDC-265 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5400 UPDATE PDC-263 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5409 UPDATE PDC-275 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5408 UPDATE PDC-274 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5231 UPDATE OXA-947 penam; antibiotic inactivation; OXA-679-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-679-like beta-lactamase UPDATED category_aro_cvterm_id with 46522 UPDATED category_aro_accession with 3007733 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-679. " 5232 UPDATE OXA-948 penam; antibiotic inactivation; OXA-679-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-679-like beta-lactamase UPDATED category_aro_cvterm_id with 46522 UPDATED category_aro_accession with 3007733 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-679. " 4260 UPDATE ADC-195 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4261 UPDATE ADC-196 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4262 UPDATE ADC-197 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4263 UPDATE ADC-198 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4264 UPDATE ADC-199 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4265 UPDATE ADC-200 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4266 UPDATE ADC-201 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4267 UPDATE ADC-202 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4268 UPDATE ADC-203 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4269 UPDATE ADC-204 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 1343 UPDATE OXA-166 antibiotic inactivation; penam; OXA-23-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-23-like beta-lactamase UPDATED category_aro_cvterm_id with 46499 UPDATED category_aro_accession with 3007710 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases, specifically imipenem, derived from OXA-23, first identified in Acinetobacter baumannii. " 1347 UPDATE OXA-425 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5548 UPDATE PDC-419 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5549 UPDATE PDC-42 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5542 UPDATE PDC-412 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5543 UPDATE PDC-414 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5540 UPDATE PDC-410 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5541 UPDATE PDC-411 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5546 UPDATE PDC-417 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5547 UPDATE PDC-418 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5544 UPDATE PDC-415 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5545 UPDATE PDC-416 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 1502 UPDATE OXA-209 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 " 655 UPDATE OXA-243 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 " 1881 UPDATE OXA-72 penam; antibiotic inactivation; OXA-24-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-24-like beta-lactamase UPDATED category_aro_cvterm_id with 46500 UPDATED category_aro_accession with 3007711 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-24. " 3885 UPDATE OXA-812 antibiotic inactivation; penam; OXA-23-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-23-like beta-lactamase UPDATED category_aro_cvterm_id with 46499 UPDATED category_aro_accession with 3007710 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases, specifically imipenem, derived from OXA-23, first identified in Acinetobacter baumannii. " 3884 UPDATE OXA-818 antibiotic inactivation; penam; OXA-23-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-23-like beta-lactamase UPDATED category_aro_cvterm_id with 46499 UPDATED category_aro_accession with 3007710 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases, specifically imipenem, derived from OXA-23, first identified in Acinetobacter baumannii. " 3883 UPDATE OXA-668 antibiotic inactivation; penam; OXA-274-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-274-like beta-lactamase UPDATED category_aro_cvterm_id with 46502 UPDATED category_aro_accession with 3007713 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-274. " 2126 UPDATE Mycobacteroides abscessus 16S rRNA mutation conferring resistance to tobramycin antibiotic target alteration; aminoglycoside antibiotic; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; tobramycin; model_sequences "UPDATED fmin with 1462397 " 4664 UPDATE GRD23-1 GRD23 beta-lactamase; carbapenem; antibiotic inactivation; model_sequences "UPDATED fmin with 0 " 2128 UPDATE Mycobacteroides abscessus 16S rRNA mutation conferring resistance to gentamicin antibiotic target alteration; aminoglycoside antibiotic; gentamicin C; gentamicin; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; model_sequences "UPDATED fmin with 1462397 " 4666 UPDATE IMI-12 carbapenem; antibiotic inactivation; IMI beta-lactamase; model_sequences "UPDATED fmin with 0 " 4667 UPDATE IMI-13 carbapenem; antibiotic inactivation; IMI beta-lactamase; model_sequences "UPDATED fmin with 0 " 4912 UPDATE OXA-586 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 4913 UPDATE OXA-587 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 4662 UPDATE GOB-50 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 4663 UPDATE GOB-51 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 326 UPDATE OXA-225 antibiotic inactivation; penam; OXA-23-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-23-like beta-lactamase UPDATED category_aro_cvterm_id with 46499 UPDATED category_aro_accession with 3007710 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases, specifically imipenem, derived from OXA-23, first identified in Acinetobacter baumannii. " 1882 UPDATE OXA-80 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4714 UPDATE KLUC-1 antibiotic inactivation; KLUC beta-lactamase; cephalosporin; model_sequences "UPDATED fmin with 100 " 4715 UPDATE KLUC-2 antibiotic inactivation; KLUC beta-lactamase; cephalosporin; model_sequences "UPDATED fmin with 100 " 4716 UPDATE KLUC-3 antibiotic inactivation; KLUC beta-lactamase; cephalosporin; model_sequences "UPDATED fmin with 0 " 4717 UPDATE KLUC-4 antibiotic inactivation; KLUC beta-lactamase; cephalosporin; model_sequences "UPDATED fmin with 0 " 4710 UPDATE IMP-85 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 0 " 4711 UPDATE IMP-88 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 0 " 4712 UPDATE IMP-89 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 100 " 4713 UPDATE IND-16 carbapenem; antibiotic inactivation; IND beta-lactamase; model_sequences "UPDATED fmin with 0 " 4718 UPDATE KLUC-5 antibiotic inactivation; KLUC beta-lactamase; cephalosporin; model_sequences "UPDATED fmin with 100 " 4719 UPDATE KPC-21 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; model_sequences "UPDATED fmin with 0 " 4479 UPDATE CMY-8b antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 0 " 4478 UPDATE CMY-174 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 100 " 4471 UPDATE CMY-131 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 0 " 4470 UPDATE CMY-109 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 0 " 4473 UPDATE CMY-159 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 0 " 4472 UPDATE CMY-137 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 100 " 4475 UPDATE CMY-168 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 0 " 4474 UPDATE CMY-167 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 0 " 4477 UPDATE CMY-170 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 0 " 4476 UPDATE CMY-169 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 0 " 6006 UPDATE OXA-481 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 " 4908 UPDATE OXA-582 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 947 UPDATE OXA-100 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4679 UPDATE IMP-17 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 100 " 4678 UPDATE IMI-9 carbapenem; antibiotic inactivation; IMI beta-lactamase; model_sequences "UPDATED fmin with 100 " 4901 UPDATE OXA-575 penam; antibiotic inactivation; OXA-214-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-214-like beta-lactamase UPDATED category_aro_cvterm_id with 46496 UPDATED category_aro_accession with 3007707 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-214. " 4900 UPDATE OXA-574 penam; antibiotic inactivation; OXA-22-like beta-lactamase; cephalosporin; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-22-like beta-lactamase UPDATED category_aro_cvterm_id with 46497 UPDATED category_aro_accession with 3007708 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-22. " 4903 UPDATE OXA-577 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 4902 UPDATE OXA-576 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 " 4673 UPDATE IMI-19 carbapenem; antibiotic inactivation; IMI beta-lactamase; model_sequences "UPDATED fmin with 0 " 4672 UPDATE IMI-18 carbapenem; antibiotic inactivation; IMI beta-lactamase; model_sequences "UPDATED fmin with 0 " 4907 UPDATE OXA-581 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 4906 UPDATE OXA-580 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 5148 UPDATE OXA-851 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; OXA-50-like beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-50-like beta-lactamase UPDATED category_aro_cvterm_id with 46513 UPDATED category_aro_accession with 3007724 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-50. " 5149 UPDATE OXA-852 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 13 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5146 UPDATE OXA-848 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; OXA-50-like beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-50-like beta-lactamase UPDATED category_aro_cvterm_id with 46513 UPDATED category_aro_accession with 3007724 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-50. " 5147 UPDATE OXA-849 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; OXA-50-like beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-50-like beta-lactamase UPDATED category_aro_cvterm_id with 46513 UPDATED category_aro_accession with 3007724 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-50. " 5144 UPDATE OXA-845 penam; antibiotic inactivation; OXA-214-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-214-like beta-lactamase UPDATED category_aro_cvterm_id with 46496 UPDATED category_aro_accession with 3007707 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-214. " 5145 UPDATE OXA-847 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; OXA-50-like beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-50-like beta-lactamase UPDATED category_aro_cvterm_id with 46513 UPDATED category_aro_accession with 3007724 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-50. " 5142 UPDATE OXA-843 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 5143 UPDATE OXA-844 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 5140 UPDATE OXA-841 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 5141 UPDATE OXA-842 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 3405 UPDATE OXA-402 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 3407 UPDATE OXA-103 antibiotic inactivation; penam; OXA-23-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-23-like beta-lactamase UPDATED category_aro_cvterm_id with 46499 UPDATED category_aro_accession with 3007710 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases, specifically imipenem, derived from OXA-23, first identified in Acinetobacter baumannii. " 3406 UPDATE OXA-140 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 " 3409 UPDATE OXA-123 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 3408 UPDATE OXA-122 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5341 UPDATE PDC-202 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 4875 UPDATE OXA-546 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 4874 UPDATE OXA-545 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4877 UPDATE OXA-548 OXA-548-like beta-lactamase; penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-548-like beta-lactamase UPDATED category_aro_cvterm_id with 46515 UPDATED category_aro_accession with 3007726 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-548. " 4876 UPDATE OXA-547 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 18 DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 4871 UPDATE OXA-537 penam; antibiotic inactivation; OXA-134-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-134-like beta-lactamase UPDATED category_aro_cvterm_id with 46489 UPDATED category_aro_accession with 3007700 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-134. " 4870 UPDATE OXA-536 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4873 UPDATE OXA-542 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 " 4872 UPDATE OXA-538 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 23 DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 4879 UPDATE OXA-550 OXA-548-like beta-lactamase; penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-548-like beta-lactamase UPDATED category_aro_cvterm_id with 46515 UPDATED category_aro_accession with 3007726 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-548. " 4878 UPDATE OXA-549 OXA-548-like beta-lactamase; penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-548-like beta-lactamase UPDATED category_aro_cvterm_id with 46515 UPDATED category_aro_accession with 3007726 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-548. " 2068 UPDATE Escherichia coli 16S rRNA mutation conferring resistance to edeine 16s rRNA with mutation conferring resistance to peptide antibiotics; edeine B; edeine F; edeine D; peptide antibiotic; antibiotic target alteration; edeine A; model_sequences "UPDATED fmin with 4166658 " 2069 UPDATE Escherichia coli 16S rRNA (rrsB) mutation conferring resistance to neomycin antibiotic target alteration; aminoglycoside antibiotic; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; neomycin; model_sequences "UPDATED fmin with 4166658 " 1187 UPDATE OXA-248 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 942 UPDATE OXA-104 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 1185 UPDATE OXA-176 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5098 UPDATE OXA-793 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 5099 UPDATE OXA-794 penam; OXA-10-like beta-lactamase; cephalosporin; antibiotic inactivation; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-10-like beta-lactamase UPDATED category_aro_cvterm_id with 46486 UPDATED category_aro_accession with 3007697 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-10. " 5090 UPDATE OXA-782 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5091 UPDATE OXA-783 penam; OXA-184-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-184-like beta-lactamase UPDATED category_aro_cvterm_id with 46491 UPDATED category_aro_accession with 3007702 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-184. " 5092 UPDATE OXA-784 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 5093 UPDATE OXA-785 penam; OXA-184-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-184-like beta-lactamase UPDATED category_aro_cvterm_id with 46491 UPDATED category_aro_accession with 3007702 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-184. " 5094 UPDATE OXA-786 penam; OXA-61-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-61-like beta-lactamase UPDATED category_aro_cvterm_id with 46519 UPDATED category_aro_accession with 3007730 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-61. " 5095 UPDATE OXA-787 penam; antibiotic inactivation; OXA-364-like beta-lactamase; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-364-like beta-lactamase UPDATED category_aro_cvterm_id with 46505 UPDATED category_aro_accession with 3007716 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-364. " 5096 UPDATE OXA-788 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 5097 UPDATE OXA-789 penam; antibiotic inactivation; OXA-364-like beta-lactamase; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-364-like beta-lactamase UPDATED category_aro_cvterm_id with 46505 UPDATED category_aro_accession with 3007716 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-364. " 4497 UPDATE CTX-M-168 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4496 UPDATE CTX-M-167 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4495 UPDATE CTX-M-154 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4494 UPDATE CTX-M-153 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4493 UPDATE CTX-M-150 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4492 UPDATE CTX-M-146 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 100 " 4491 UPDATE CTX-M-143 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4490 UPDATE CTX-M-140 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 100 " 4499 UPDATE CTX-M-170 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 0 " 4498 UPDATE CTX-M-169 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED fmin with 100 " 5326 UPDATE PDC-187 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5327 UPDATE PDC-188 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5324 UPDATE PDC-185 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5325 UPDATE PDC-186 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5322 UPDATE PDC-182 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5323 UPDATE PDC-184 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5320 UPDATE PDC-180 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5321 UPDATE PDC-181 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5328 UPDATE PDC-189 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5329 UPDATE PDC-190 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 1641 UPDATE OXA-203 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4365 UPDATE AXC-3 AXC beta-lactamase; carbapenem; antibiotic inactivation; model_sequences "UPDATED fmin with 0 " 4364 UPDATE AXC-2 AXC beta-lactamase; carbapenem; antibiotic inactivation; model_sequences "UPDATED fmin with 0 " 573 UPDATE OXA-136 penam; antibiotic inactivation; OXA beta-lactamase; OXA-63-like beta-lactamase; oxacillin; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-63-like beta-lactamase UPDATED category_aro_cvterm_id with 46521 UPDATED category_aro_accession with 3007732 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-63. " 572 UPDATE OXA-137 penam; antibiotic inactivation; OXA beta-lactamase; OXA-63-like beta-lactamase; oxacillin; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-63-like beta-lactamase UPDATED category_aro_cvterm_id with 46521 UPDATED category_aro_accession with 3007732 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-63. " 5432 UPDATE PDC-301 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5433 UPDATE PDC-302 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5430 UPDATE PDC-30 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5431 UPDATE PDC-300 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5436 UPDATE PDC-305 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5437 UPDATE PDC-307 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5434 UPDATE PDC-303 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5435 UPDATE PDC-304 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5438 UPDATE PDC-308 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5439 UPDATE PDC-309 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 4982 UPDATE OXA-662 antibiotic inactivation; penam; OXA-211-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-211-like beta-lactamase UPDATED category_aro_cvterm_id with 46494 UPDATED category_aro_accession with 3007705 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-211. " 5652 UPDATE SHV-115 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences "UPDATED fmin with 0 " 4273 UPDATE ADC-208 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4272 UPDATE ADC-207 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4271 UPDATE ADC-206 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4270 UPDATE ADC-205 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4277 UPDATE ADC-212 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 85 " 4276 UPDATE ADC-211 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4275 UPDATE ADC-210 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4274 UPDATE ADC-209 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 1352 UPDATE OXA-251 penam; OXA-10-like beta-lactamase; cephalosporin; antibiotic inactivation; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-10-like beta-lactamase UPDATED category_aro_cvterm_id with 46486 UPDATED category_aro_accession with 3007697 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-10. " 4279 UPDATE ADC-214 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 86 " 4278 UPDATE ADC-213 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 99 " 461 UPDATE OXA-13 penam; OXA-10-like beta-lactamase; cephalosporin; antibiotic inactivation; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-10-like beta-lactamase UPDATED category_aro_cvterm_id with 46486 UPDATED category_aro_accession with 3007697 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-10. " 608 UPDATE OXA-361 penam; antibiotic inactivation; OXA-134-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-134-like beta-lactamase UPDATED category_aro_cvterm_id with 46489 UPDATED category_aro_accession with 3007700 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-134. " 5555 UPDATE PDC-425 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5554 UPDATE PDC-424 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5557 UPDATE PDC-427 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5556 UPDATE PDC-426 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5551 UPDATE PDC-421 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5550 UPDATE PDC-420 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5553 UPDATE PDC-423 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5552 UPDATE PDC-422 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5559 UPDATE PDC-430 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5558 UPDATE PDC-428 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 4861 UPDATE OXA-526 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 1517 UPDATE OXA-33 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 " 1511 UPDATE OXA-423 antibiotic inactivation; penam; OXA-23-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-23-like beta-lactamase UPDATED category_aro_cvterm_id with 46499 UPDATED category_aro_accession with 3007710 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases, specifically imipenem, derived from OXA-23, first identified in Acinetobacter baumannii. " 959 UPDATE OXA-64 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 958 UPDATE OXA-418 antibiotic inactivation; penam; OXA-229-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-229-like beta-lactamase UPDATED category_aro_cvterm_id with 46498 UPDATED category_aro_accession with 3007709 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-229. " 4373 UPDATE BlaB-12 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences "UPDATED fmin with 0 " 5646 UPDATE SGM-3 carbapenem; antibiotic inactivation; SGM beta-lactamase; model_sequences "UPDATED fmin with 100 " 4227 UPDATE ADC-157 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4707 UPDATE IMP-82 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 0 " 4706 UPDATE IMP-81 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 0 " 4705 UPDATE IMP-80 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 0 " 4704 UPDATE IMP-79 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 0 " 4703 UPDATE IMP-78 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 0 " 4702 UPDATE IMP-77 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 0 " 4701 UPDATE IMP-76 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 0 " 4700 UPDATE IMP-75 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 0 " 4709 UPDATE IMP-84 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 0 " 4708 UPDATE IMP-83 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; model_sequences "UPDATED fmin with 0 " 289 UPDATE OXA-85 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 " 267 UPDATE OXA-43 penam; OXA-42-like beta-lactamase; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-42-like beta-lactamase UPDATED category_aro_cvterm_id with 46507 UPDATED category_aro_accession with 3007718 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-42. " 6011 UPDATE Mdtq penam; carbapenem; penem; reduced permeability to antibiotic; Outer Membrane Porin (Opr); cephalosporin; cephamycin; monobactam; ARO_description; CARD_short_name; model_name; ARO_name "UPDATED ARO_description with MdtQ is a putative multidrug resistance outer membrane protein found in carbapenem resistant Klebsiella pneumoniae. UPDATED CARD_short_name with MdtQ UPDATED model_name with MdtQ UPDATED ARO_name with MdtQ " 6010 UPDATE OXA-105 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; ARO_category "DELETED 35939 " 4648 UPDATE GOB-35 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 4649 UPDATE GOB-36 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 4642 UPDATE GOB-29 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 4643 UPDATE GOB-30 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 4640 UPDATE GOB-27 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 4641 UPDATE GOB-28 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 4646 UPDATE GOB-33 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 4631 UPDATE GMB-1 carbapenem; GMB beta-lactamase; antibiotic inactivation; model_sequences "UPDATED fmin with 0 " 4644 UPDATE GOB-31 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 4645 UPDATE GOB-32 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 4424 UPDATE CARB-40 penam; antibiotic inactivation; CARB beta-lactamase; model_sequences "UPDATED fmin with 0 " 5159 UPDATE OXA-862 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 28 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5158 UPDATE OXA-861 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 31 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5151 UPDATE OXA-854 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 13 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5150 UPDATE OXA-853 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 28 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5153 UPDATE OXA-856 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 18 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5152 UPDATE OXA-855 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 24 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5155 UPDATE OXA-858 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 30 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5154 UPDATE OXA-857 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 27 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5157 UPDATE OXA-860 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 12 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5156 UPDATE OXA-859 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 15 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 4800 UPDATE ORN-6 carbapenem; ORN beta-lactamase; cephalosporin; antibiotic inactivation; model_sequences "UPDATED fmin with 100 " 4801 UPDATE ORR-1 carbapenem; antibiotic inactivation; ORR beta-lactamase; model_sequences "UPDATED fmin with 100 " 4802 UPDATE OXA-114b OXA-114-like beta-lactamase; penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-114-like beta-lactamase UPDATED category_aro_cvterm_id with 46487 UPDATED category_aro_accession with 3007698 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-114. " 4803 UPDATE OXA-114c OXA-114-like beta-lactamase; penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-114-like beta-lactamase UPDATED category_aro_cvterm_id with 46487 UPDATED category_aro_accession with 3007698 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-114. " 4804 UPDATE OXA-114d OXA-114-like beta-lactamase; penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-114-like beta-lactamase UPDATED category_aro_cvterm_id with 46487 UPDATED category_aro_accession with 3007698 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-114. " 4805 UPDATE OXA-114e OXA-114-like beta-lactamase; penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-114-like beta-lactamase UPDATED category_aro_cvterm_id with 46487 UPDATED category_aro_accession with 3007698 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-114. " 4806 UPDATE OXA-114f OXA-114-like beta-lactamase; penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-114-like beta-lactamase UPDATED category_aro_cvterm_id with 46487 UPDATED category_aro_accession with 3007698 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-114. " 4807 UPDATE OXA-114g OXA-114-like beta-lactamase; penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-114-like beta-lactamase UPDATED category_aro_cvterm_id with 46487 UPDATED category_aro_accession with 3007698 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-114. " 4808 UPDATE OXA-114h OXA-114-like beta-lactamase; penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-114-like beta-lactamase UPDATED category_aro_cvterm_id with 46487 UPDATED category_aro_accession with 3007698 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-114. " 4809 UPDATE OXA-114i OXA-114-like beta-lactamase; penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35939 UPDATED category_aro_name with OXA-114-like beta-lactamase UPDATED category_aro_cvterm_id with 46487 UPDATED category_aro_accession with 3007698 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-114. " 2078 UPDATE Mycobacteroides chelonae 16S rRNA mutation conferring resistance to kanamycin A kanamycin A; antibiotic target alteration; aminoglycoside antibiotic; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; model_sequences "UPDATED fmin with 0 " 2073 UPDATE Escherichia coli 16S rRNA (rrsB) mutation conferring resistance to G418 antibiotic target alteration; aminoglycoside antibiotic; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; G418; model_sequences "UPDATED fmin with 4166658 " 2070 UPDATE Mycobacterium tuberculosis 16S rRNA mutation conferring resistance to amikacin antibiotic target alteration; amikacin; aminoglycoside antibiotic; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; model_sequences "UPDATED fmin with 1471845 " 2074 UPDATE Salmonella enterica 16S rRNA (rrsD) mutation conferring resistance to spectinomycin antibiotic target alteration; aminoglycoside antibiotic; spectinomycin; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; model_sequences "UPDATED fmin with 3570462 " 3508 UPDATE OXA-438 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 3509 UPDATE OXA-439 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 5089 UPDATE OXA-781 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5088 UPDATE OXA-780 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; model_sequences; ARO_category "UPDATED fmin with 100 DELETED 35939 " 5083 UPDATE OXA-774 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 22 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5082 UPDATE OXA-773 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 23 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5081 UPDATE OXA-772 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 42 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5080 UPDATE OXA-771 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 35 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5087 UPDATE OXA-778 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 0 DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 3505 UPDATE OXA-432 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5085 UPDATE OXA-776 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 15 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5084 UPDATE OXA-775 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 13 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5331 UPDATE PDC-192 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5330 UPDATE PDC-191 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5333 UPDATE PDC-194 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5332 UPDATE PDC-193 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5335 UPDATE PDC-196 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5334 UPDATE PDC-195 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5337 UPDATE PDC-198 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5336 UPDATE PDC-197 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5339 UPDATE PDC-20 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5338 UPDATE PDC-199 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 1986 UPDATE OXA-309 antibiotic inactivation; penam; OXA-211-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-211-like beta-lactamase UPDATED category_aro_cvterm_id with 46494 UPDATED category_aro_accession with 3007705 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-211. " 1980 UPDATE OXA-247 penam; antibiotic inactivation; OXA-48-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-48-like beta-lactamase UPDATED category_aro_cvterm_id with 46510 UPDATED category_aro_accession with 3007721 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-48-type beta-lactamases are now routinely encountered in bacterial infections caused by carbapenam-resistant Enterobacterales. OXA-48-like proteins confer resistance to penicillin (which is efficiently hydrolyzed) and carbapenam antibiotics (which is more slowly broken down). The spectrum of activity of these variants varies, with some hydrolyzing expanded-spectrum oxyimino-cephalosporins. " 1981 UPDATE vanA glycopeptide resistance gene cluster; Van ligase; teicoplanin; glycopeptide antibiotic; antibiotic target alteration; vancomycin; model_sequences "UPDATED fmin with 6978 " 569 UPDATE OXA-228 antibiotic inactivation; penam; OXA-229-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-229-like beta-lactamase UPDATED category_aro_cvterm_id with 46498 UPDATED category_aro_accession with 3007709 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-229. " 560 UPDATE OXA-77 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 566 UPDATE OXA-32 penam; antibiotic inactivation; OXA-2-like beta-lactamase; cephalosporin; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-2-like beta-lactamase UPDATED category_aro_cvterm_id with 46493 UPDATED category_aro_accession with 3007704 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-2. " 5429 UPDATE PDC-299 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5428 UPDATE PDC-298 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5425 UPDATE PDC-295 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5424 UPDATE PDC-294 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5427 UPDATE PDC-297 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5426 UPDATE PDC-296 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5421 UPDATE PDC-289 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5420 UPDATE PDC-288 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5423 UPDATE PDC-291 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5422 UPDATE PDC-290 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 4390 UPDATE BlaB-29 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences "UPDATED fmin with 100 " 722 UPDATE vanR gene in vanA cluster vanR; glycopeptide resistance gene cluster; teicoplanin; glycopeptide antibiotic; antibiotic target alteration; vancomycin; model_sequences "UPDATED fmin with 3975 " 721 UPDATE OXA-28 penam; OXA-10-like beta-lactamase; cephalosporin; antibiotic inactivation; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-10-like beta-lactamase UPDATED category_aro_cvterm_id with 46486 UPDATED category_aro_accession with 3007697 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-10. " 1741 UPDATE OXA-359 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 1743 UPDATE OXA-338 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5637 UPDATE RAHN-2 antibiotic inactivation; cephalosporin; RAHN beta-lactamase; model_sequences "UPDATED fmin with 100 " 4248 UPDATE ADC-180 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4249 UPDATE ADC-184 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4246 UPDATE ADC-178 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4247 UPDATE ADC-179 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4244 UPDATE ADC-176 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4245 UPDATE ADC-177 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4242 UPDATE ADC-174 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4243 UPDATE ADC-175 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 0 " 4240 UPDATE ADC-172 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 4241 UPDATE ADC-173 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED fmin with 100 " 5520 UPDATE PDC-390 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5521 UPDATE PDC-391 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5522 UPDATE PDC-392 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5523 UPDATE PDC-394 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5524 UPDATE PDC-395 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5525 UPDATE PDC-396 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5526 UPDATE PDC-397 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5527 UPDATE PDC-398 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5528 UPDATE PDC-399 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 5529 UPDATE PDC-40 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED fmin with 0 " 4397 UPDATE BlaB-35 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences "UPDATED fmin with 100 " 48 UPDATE OXA-90 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 47 UPDATE OXA-60 penam; antibiotic inactivation; OXA-60-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-60-like beta-lactamase UPDATED category_aro_cvterm_id with 46518 UPDATED category_aro_accession with 3007729 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-60. " 1568 UPDATE OXA-183 penam; OXA-10-like beta-lactamase; cephalosporin; antibiotic inactivation; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-10-like beta-lactamase UPDATED category_aro_cvterm_id with 46486 UPDATED category_aro_accession with 3007697 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of extended-spectrum oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-10. " 5020 UPDATE OXA-708 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; model_sequences; ARO_category "UPDATED fmin with 19 DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 1293 UPDATE OXA-197 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 1361 UPDATE OXA-223 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 795 UPDATE OXA-324 penam; antibiotic inactivation; OXA-213-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-213-like beta-lactamase UPDATED category_aro_cvterm_id with 46495 UPDATED category_aro_accession with 3007706 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with OXA-213-like enzymes have been identified to be intrinsic to A. calcoaceticus and have been subsequently detected in A. pittii. Phylogenetic analysis of OXA-213-like proteins identified two distinct subgroups within the OXA family. The first group was linked to A. pittii and the second group to A. calcoaceticus. The carbapenemase activity of these OXAs may be related to the species-dependent effect. " 1717 UPDATE OXA-230 antibiotic inactivation; penam; OXA-229-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-229-like beta-lactamase UPDATED category_aro_cvterm_id with 46498 UPDATED category_aro_accession with 3007709 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases derived from OXA-229. " 1716 UPDATE OXA-398 antibiotic inactivation; penam; OXA-23-like beta-lactamase; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-23-like beta-lactamase UPDATED category_aro_cvterm_id with 46499 UPDATED category_aro_accession with 3007710 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of carbapenem-hydrolyzing class D OXA beta-lactamases, specifically imipenem, derived from OXA-23, first identified in Acinetobacter baumannii. " 4398 UPDATE BlaB-36 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences "UPDATED fmin with 100 " 4399 UPDATE BlaB-38 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences "UPDATED fmin with 100 " 5638 UPDATE RSA2-1 carbapenem; RSA2 beta-lactamase; antibiotic inactivation; model_sequences "UPDATED fmin with 0 " 5639 UPDATE RSD2-1 RSD2 beta-lactamase; carbapenem; cephalosporin; antibiotic inactivation; model_sequences "UPDATED fmin with 0 " 4441 UPDATE CDD-2 carbapenem; antibiotic inactivation; CDD beta-lactamase; model_sequences "UPDATED fmin with 100 " 5634 UPDATE PST-2 PST beta-lactamase; carbapenem; antibiotic inactivation; model_sequences "UPDATED fmin with 0 " 5635 UPDATE PSV-1 carbapenem; antibiotic inactivation; cephalosporin; PSV beta-lactamase; model_sequences "UPDATED fmin with 100 " 5636 UPDATE RAHN-1 antibiotic inactivation; cephalosporin; RAHN beta-lactamase; model_sequences "UPDATED fmin with 100 " 4393 UPDATE BlaB-31 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences "UPDATED fmin with 0 " 5630 UPDATE PME-1 carbapenem; antibiotic inactivation; PME beta-lactamase; model_sequences "UPDATED fmin with 100 " 5631 UPDATE POM-1 carbapenem; POM beta-lactamase; antibiotic inactivation; model_sequences "UPDATED fmin with 100 " 5632 UPDATE POM-2 carbapenem; POM beta-lactamase; antibiotic inactivation; model_sequences "UPDATED fmin with 0 " 5633 UPDATE PST-1 PST beta-lactamase; carbapenem; antibiotic inactivation; model_sequences "UPDATED fmin with 100 " 964 UPDATE OXA-129 penam; antibiotic inactivation; OXA beta-lactamase; oxacillin; OXA-5-like beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-5-like beta-lactamase UPDATED category_aro_cvterm_id with 46512 UPDATED category_aro_accession with 3007723 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-5. " 470 UPDATE OXA-4 penam; antibiotic inactivation; OXA-1-like beta-lactamase; cephalosporin; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35939 UPDATED category_aro_name with OXA-1-like beta-lactamase UPDATED category_aro_cvterm_id with 46485 UPDATED category_aro_accession with 3007696 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of oxacillin-hydrolyzing class D OXA beta-lactamases derived from OXA-1. " 4443 UPDATE CepA-44 CepA beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences "UPDATED fmin with 100 " 475 UPDATE OXA-106 antibiotic inactivation; OXA-51-like beta-lactamase; penam; carbapenem; oxacillin; OXA beta-lactamase; ARO_category "DELETED 35930 UPDATED category_aro_name with OXA-51-like beta-lactamase UPDATED category_aro_cvterm_id with 46514 UPDATED category_aro_accession with 3007725 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with The maximum number of blaOXA belonged to the OXA-51-like subfamily. An earlier study had reported that OXA-51-like enzymes were present exclusively in A. baumannii. Similar to most of the other OXA-type carbapenemases, the OXA-51-like enzymes show weak carbapenemase activity; however, the presence of the insertion sequence ISAba1 upstream of the blaOXA-51-like gene may provide a promoter that allows the overproduction of carbapenemase, and this results in carbapenem resistance. " 5966 DELETE dfrv trimethoprim; diaminopyrimidine antibiotic; trimethoprim resistant dihydrofolate reductase dfr; antibiotic target replacement; N/A N/A 6013 ADD AMZ-1 penam; antibiotic inactivation; AMZ beta-lactamase; cephalosporin; benzylpenicillin; cefalotin; cephamycin; ampicillin; amoxicillin; cefoxitin; N/A N/A 6012 ADD Mycobacterium tuberculosis Rv2535c with mutation conferring resistance to bedaquiline bedaquiline resistant Rv2535c; diarylquinoline antibiotic; bedaquiline; clofazimine; antibiotic target alteration; fluoroquinolone antibiotic; N/A N/A 6015 ADD Salmonella gallinarum folP with mutation conferring resistance to sulfonamides antibiotic target alteration; sulfonamide resistant dihydropteroate synthase folP; sulfamethoxazole; sulfonamide antibiotic; N/A N/A 6014 ADD CMY-185 antibiotic inactivation; CMY beta-lactamase; cephamycin; N/A N/A 6017 ADD Salmonella isangi gyrB conferring resistance to fluoroquinolones antibiotic target alteration; nalidixic acid; fluoroquinolone antibiotic; fluoroquinolone resistant gyrB; ciprofloxacin; N/A N/A 6016 ADD Salmonella isangi gyrA conferring resistance to fluoroquinolones antibiotic target alteration; nalidixic acid; fluoroquinolone antibiotic; fluoroquinolone resistant gyrA; ciprofloxacin; N/A N/A 6019 ADD Treponema pallidum 23S rRNA with mutation conferring resistance to erythromycin antibiotic target alteration; 23S rRNA with mutation conferring resistance to macrolide antibiotics; macrolide antibiotic; erythromycin; N/A N/A