Model_id Action ARO_name ARO_category Changes To Summary 8560 ADD OXA-1054 OXA-372-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; N/A N/A 8563 ADD AAC(6')-Va AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; N/A N/A 8562 ADD MrmA Cfr-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; oxazolidinone antibiotic; phenicol antibiotic; antibiotic target alteration; N/A N/A 8530 ADD Mycobacterium tuberculosis fbiA with mutation conferring resistance to delamanid antibiotic resistant F420 biosynthesis protein; nitroimidazole antibiotic; antibiotic target alteration; N/A N/A 8531 ADD Mycobacterium tuberculosis fbiB with mutation conferring resistance to delamanid antibiotic resistant F420 biosynthesis protein; nitroimidazole antibiotic; antibiotic target alteration; N/A N/A 8532 ADD Mycobacterium tuberculosis fbiC with mutation conferring resistance to delamanid antibiotic resistant F420 biosynthesis protein; nitroimidazole antibiotic; antibiotic target alteration; N/A N/A 8533 ADD Mycobacterium tuberculosis eis with mutation conferring resistance to amikacin amikacin-resistant eis; aminoglycoside antibiotic; antibiotic target alteration; N/A N/A 8527 ADD Mycobacterium tuberculosis Rv2535c with mutation conferring resistance to clofazimine clofazimine resistant Rv2535c; antibiotic without defined classification; antibiotic target alteration; N/A N/A 8535 ADD KPC-20 KPC beta-lactamase; monobactam; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; N/A N/A 8537 ADD VIM-92 VIM beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; N/A N/A 8538 ADD AMM-1 AMM beta-lactamase; carbapenem; antibiotic inactivation; N/A N/A 8539 ADD AMM-2 AMM beta-lactamase; carbapenem; antibiotic inactivation; N/A N/A 8540 ADD erm(55) Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; N/A N/A 2 UPDATE CblA-1 CblA beta-lactamase; cephalosporin; antibiotic inactivation; ARO_category "DELETED 41256 " 5 UPDATE dfrF trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 7 UPDATE CTX-M-130 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 11 UPDATE Erm(34) Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35925 " 12 UPDATE TEM-126 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 14 UPDATE TEM-72 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 15 UPDATE TEM-59 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 18 UPDATE OXA-212 OXA-211-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 21 UPDATE OXA-329 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 23 UPDATE OXA-371 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 24 UPDATE fusB Target protecting FusB-type protein conferring resistance to Fusidic acid; fusidane antibiotic; antibiotic target protection; ARO_category "DELETED 37139 " 25 UPDATE CTX-M-121 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 27 UPDATE lnuA lincosamide nucleotidyltransferase (LNU); lincosamide antibiotic; antibiotic inactivation; ARO_category "DELETED 35964 " 28 UPDATE OXA-45 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 30 UPDATE OXA-226 OXA-2-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 31 UPDATE CTX-M-155 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 33 UPDATE msrE msr-type ABC-F protein; macrolide antibiotic; streptogramin antibiotic; antibiotic target protection; ARO_category "DELETED 35925 " 35 UPDATE FosA2 fosfomycin thiol transferase; phosphonic acid antibiotic; antibiotic inactivation; ARO_category "DELETED 35944 " 38 UPDATE APH(3')-Va APH(3'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35924 " 39 UPDATE AAC(3)-Ia AAC(3); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35922 " 40 UPDATE QnrB58 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 41 UPDATE rmtH 16S rRNA methyltransferase (G1405); aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35932 " 44 UPDATE golS resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; monobactam; carbapenem; cephalosporin; penicillin beta-lactam; phenicol antibiotic; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 36524 " 45 UPDATE mdtP major facilitator superfamily (MFS) antibiotic efflux pump; nucleoside antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 35963 " 47 UPDATE OXA-60 OXA-60-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 48 UPDATE OXA-90 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 51 UPDATE AAC(3)-IIIc AAC(3); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 40942 " 54 UPDATE TEM-34 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 55 UPDATE OXA-69 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 56 UPDATE TEM-7 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 58 UPDATE QnrB47 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 59 UPDATE OXA-256 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 60 UPDATE QnrS6 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 61 UPDATE OXA-330 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 62 UPDATE CMY-42 CMY beta-lactamase; cephalosporin; antibiotic inactivation; ARO_category "DELETED 35927 " 63 UPDATE AAC(6')-Ib AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35932 " 67 UPDATE OXA-391 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 68 UPDATE TEM-132 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 69 UPDATE aadA23 ANT(3''); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35957 " 71 UPDATE QnrB66 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 73 UPDATE OXA-35 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 75 UPDATE fusH fusidic acid inactivation enzyme; fusidane antibiotic; antibiotic inactivation; ARO_category "DELETED 37139 " 77 UPDATE TEM-47 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 78 UPDATE TEM-16 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 86 UPDATE TEM-102 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 87 UPDATE TEM-116 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 91 UPDATE gadX resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; macrolide antibiotic; fluoroquinolone antibiotic; penicillin beta-lactam; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35925 " 92 UPDATE CTX-M-42 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 96 UPDATE OXA-426 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 99 UPDATE QnrB38 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 101 UPDATE TEM-109 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 103 UPDATE SHV-12 SHV beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 104 UPDATE OXA-61 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 106 UPDATE catB9 chloramphenicol acetyltransferase (CAT); phenicol antibiotic; antibiotic inactivation; ARO_category "DELETED 36521 " 107 UPDATE TEM-43 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 109 UPDATE ErmE Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35925 " 110 UPDATE AAC(6')-Iu AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 114 UPDATE dfrA13 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 115 UPDATE TEM-87 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 116 UPDATE QnrB18 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 120 UPDATE aadA4 ANT(3''); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35957 " 121 UPDATE mdtF resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; fluoroquinolone antibiotic; penicillin beta-lactam; antibiotic efflux; ARO_category "DELETED 35925 " 126 UPDATE TEM-183 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 127 UPDATE clbB Cfr-like 23S rRNA methyltransferase; lincosamide antibiotic; streptogramin antibiotic; oxazolidinone antibiotic; phenicol antibiotic; pleuromutilin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Cfr-like 23S rRNA methyltransferase DELETED 35964 " 128 UPDATE srmB Miscellaneous ABC-F subfamily ATP-binding cassette ribosomal protection proteins; macrolide antibiotic; antibiotic target protection; ARO_category "DELETED 36295 " 129 UPDATE FosX fosfomycin thiol transferase; phosphonic acid antibiotic; antibiotic inactivation; ARO_category "DELETED 35944 " 130 UPDATE CTX-M-112 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 131 UPDATE CTX-M-50 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 132 UPDATE TEM-198 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 133 UPDATE arr-8 rifampin ADP-ribosyltransferase (Arr); rifamycin antibiotic; antibiotic inactivation; ARO_category "DELETED 36308 " 134 UPDATE rgt1438 rifampin glycosyltransferase; rifamycin antibiotic; antibiotic inactivation; ARO_category "DELETED 36308 " 137 UPDATE APH(2'')-Ie APH(2''); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35932 " 139 UPDATE QnrB10 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 140 UPDATE AAC(6')-IIb AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 145 UPDATE OXA-229 OXA-229-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 146 UPDATE OXA-98 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 147 UPDATE OXA-27 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 149 UPDATE aadA12 ANT(3''); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35957 " 150 UPDATE catB3 chloramphenicol acetyltransferase (CAT); phenicol antibiotic; antibiotic inactivation; ARO_category "DELETED 36521 " 152 UPDATE cpxA resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; aminoglycoside antibiotic; aminocoumarin antibiotic; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35924 " 153 UPDATE adeF resistance-nodulation-cell division (RND) antibiotic efflux pump; fluoroquinolone antibiotic; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 154 UPDATE mgrA ATP-binding cassette (ABC) antibiotic efflux pump; major facilitator superfamily (MFS) antibiotic efflux pump; antibiotic efflux regulatory protein; fluoroquinolone antibiotic; cephalosporin; penicillin beta-lactam; tetracycline antibiotic; peptide antibiotic; moenomycin antibiotic; disinfecting agents and antiseptics; nonribosomal peptide antibiotics; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35934 " 155 UPDATE TEM-195 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 156 UPDATE AAC(6')-Iaf AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 157 UPDATE dfrA21 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 158 UPDATE myrA TlrA-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with TlrA-like 23S rRNA methyltransferase UPDATED category_aro_description with 23S ribosomal RNA methyltransferases modify guanosine 748 (E. coli numbering) to confer resistance to some macrolides and lincosamides. DELETED 36284 " 159 UPDATE vgaALC vga-type ABC-F protein; lincosamide antibiotic; streptogramin antibiotic; pleuromutilin antibiotic; antibiotic target protection; ARO_category "DELETED 35964 " 160 UPDATE OXA-236 OXA-134-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 163 UPDATE OXA-376 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 164 UPDATE vanN glycopeptide resistance gene cluster; Van ligase; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 43 UPDATE tet(42) major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 17 UPDATE tet(45) major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 142 UPDATE tet(E) major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 49 UPDATE tsnR tsnR 23S rRNA methyltransferase; peptide antibiotic; ribosomally synthesized and post-translationally modified peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009652 UPDATED category_aro_cvterm_id with 48523 UPDATED category_aro_name with tsnR 23S rRNA methyltransferase UPDATED category_aro_description with TsnR gene produce 23S rRNA methyltransferase enzymes which are associated with resistance to the peptide antibiotic thiostrepton. UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_accession with 3009656 UPDATED category_aro_cvterm_id with 48527 UPDATED category_aro_name with ribosomally synthesized and post-translationally modified peptide antibiotics UPDATED category_aro_description with Ribosomally synthesized and post-translationally modified peptides (RiPPs) are a large and structurally diverse superfamily of biologically active natural products. They are generated via ribosomal translation of a peptide-encoding gene and subsequent processing of the precursor peptide by dedicated enzymes that introduce a variety of post-translational modifications, including intramolecular cyclization, dehydration and formation of heterocycles. The modifications set the 3D shape of the peptides, facilitate interaction with the target and protect them from degradation by cellular peptidases. UPDATED category_aro_class_name with Drug Class DELETED 39499 " 112 UPDATE fosA5 fosfomycin thiol transferase; fluoroquinolone antibiotic; aminoglycoside antibiotic; phosphonic acid antibiotic; antibiotic inactivation; ARO_category "DELETED 35954 " 138 UPDATE Streptomyces lividans cmlR major facilitator superfamily (MFS) antibiotic efflux pump; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 36524 " 141 UPDATE vanR gene in vanB cluster glycopeptide resistance gene cluster; vanR; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 171 UPDATE TEM-78 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 173 UPDATE arr-4 rifampin ADP-ribosyltransferase (Arr); rifamycin antibiotic; antibiotic inactivation; ARO_category "DELETED 36308 " 175 UPDATE CTX-M-24 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 179 UPDATE QnrA5 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 182 UPDATE arlS major facilitator superfamily (MFS) antibiotic efflux pump; antibiotic efflux regulatory protein; fluoroquinolone antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35954 " 183 UPDATE adeS resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; glycylcycline; tetracycline antibiotic; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35949 " 185 UPDATE OXA-232 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 186 UPDATE OXA-12 OXA-12-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 187 UPDATE OXA-348 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 189 UPDATE CTX-M-19 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 190 UPDATE OXA-195 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 191 UPDATE OXA-199 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 192 UPDATE CTX-M-38 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 193 UPDATE TEM-121 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 195 UPDATE CTX-M-58 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 197 UPDATE CTX-M-56 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 198 UPDATE TEM-138 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 205 UPDATE APH(4)-Ia APH(4); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 36353 " 206 UPDATE FomA Fom phosphotransferase family; phosphonic acid antibiotic; antibiotic inactivation; ARO_category "DELETED 35944 " 211 UPDATE TEM-206 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 213 UPDATE OXA-21 OXA-2-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 215 UPDATE bcrC undecaprenyl pyrophosphate related proteins; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35959 " 218 UPDATE npmA 16S rRNA methyltransferase (A1408); aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35924 " 220 UPDATE TEM-92 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 225 UPDATE CTX-M-88 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 226 UPDATE OXA-113 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 228 UPDATE sdiA resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; fluoroquinolone antibiotic; cephalosporin; glycylcycline; penicillin beta-lactam; tetracycline antibiotic; rifamycin antibiotic; phenicol antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35949 " 230 UPDATE OXA-422 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 231 UPDATE OXA-178 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 234 UPDATE QnrS8 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 235 UPDATE OXA-181 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 239 UPDATE OXA-83 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 243 UPDATE OXA-9 OXA-9-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 245 UPDATE cmlA5 major facilitator superfamily (MFS) antibiotic efflux pump; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 36524 " 246 UPDATE CTX-M-126 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 247 UPDATE TEM-158 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 3303 UPDATE ermZ Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 36295 " 251 UPDATE APH(3')-VIIa APH(3'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35924 " 252 UPDATE APH(9)-Ia APH(9); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35957 " 254 UPDATE OXA-150 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 258 UPDATE OXA-208 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 260 UPDATE ErmN Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35925 " 263 UPDATE dfrA24 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 264 UPDATE lsaE lsa-type ABC-F protein; lincosamide antibiotic; streptogramin antibiotic; pleuromutilin antibiotic; antibiotic target protection; ARO_category "DELETED 35964 " 266 UPDATE QnrB13 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 267 UPDATE OXA-43 OXA-42-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 272 UPDATE QnrB36 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 274 UPDATE OXA-174 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 277 UPDATE TEM-91 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 279 UPDATE CTX-M-107 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 280 UPDATE CTX-M-11 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 282 UPDATE CTX-M-125 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 284 UPDATE smeD resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; fluoroquinolone antibiotic; tetracycline antibiotic; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 285 UPDATE TEM-11 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 287 UPDATE TEM-67 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 289 UPDATE OXA-85 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 290 UPDATE vatD streptogramin vat acetyltransferase; streptogramin antibiotic; antibiotic inactivation; ARO_category "DELETED 37013 " 291 UPDATE APH(3')-Ia APH(3'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35924 " 292 UPDATE TEM-17 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 295 UPDATE OXA-145 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 300 UPDATE AAC(6')-29a AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 302 UPDATE TEM-207 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 303 UPDATE ErmQ Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35925 " 305 UPDATE chrB TlrA-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with TlrA-like 23S rRNA methyltransferase UPDATED category_aro_description with 23S ribosomal RNA methyltransferases modify guanosine 748 (E. coli numbering) to confer resistance to some macrolides and lincosamides. DELETED 36284 " 307 UPDATE CTX-M-101 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 312 UPDATE OXA-167 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 313 UPDATE OXA-143 OXA-143-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 314 UPDATE TEM-176 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 316 UPDATE CTX-M-36 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 317 UPDATE TEM-148 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 318 UPDATE OXA-358 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 319 UPDATE OXA-366 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 321 UPDATE CTX-M-35 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 323 UPDATE aadA9 ANT(3''); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35957 " 324 UPDATE QnrB54 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 172 UPDATE OprN resistance-nodulation-cell division (RND) antibiotic efflux pump; fluoroquinolone antibiotic; diaminopyrimidine antibiotic; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 35954 " 250 UPDATE Rhodococcus fascians cmr major facilitator superfamily (MFS) antibiotic efflux pump; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 36524 " 326 UPDATE OXA-225 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 240 UPDATE vanR gene in vanF cluster glycopeptide resistance gene cluster; vanR; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 329 UPDATE CTX-M-159 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 331 UPDATE TEM-166 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 253 UPDATE vanXY gene in vanG cluster glycopeptide resistance gene cluster; vanXY; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 334 UPDATE mexX resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; fluoroquinolone antibiotic; aminoglycoside antibiotic; carbapenem; cephalosporin; penicillin beta-lactam; tetracycline antibiotic; phenicol antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 35925 " 337 UPDATE adeC resistance-nodulation-cell division (RND) antibiotic efflux pump; glycylcycline; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35949 " 342 UPDATE smeS resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; aminoglycoside antibiotic; cephalosporin; penicillin beta-lactam; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 36298 " 343 UPDATE OXA-31 OXA-1-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 345 UPDATE bcrA ATP-binding cassette (ABC) antibiotic efflux pump; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35959 " 346 UPDATE QnrB23 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 349 UPDATE vanL glycopeptide resistance gene cluster; Van ligase; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 350 UPDATE ykkD small multidrug resistance (SMR) antibiotic efflux pump; aminoglycoside antibiotic; tetracycline antibiotic; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 35958 " 352 UPDATE PDC-5 PDC beta-lactamase; monobactam; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35927 " 353 UPDATE QnrB2 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 354 UPDATE QnrB24 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 356 UPDATE ErmU Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35964 " 358 UPDATE QnrB42 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 359 UPDATE TEM-112 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 360 UPDATE AAC(6')-Iy AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 361 UPDATE OXA-278 OXA-134-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 362 UPDATE CTX-M-151 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 363 UPDATE TEM-155 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 365 UPDATE TEM-122 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 367 UPDATE CTX-M-25 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 372 UPDATE qacA major facilitator superfamily (MFS) antibiotic efflux pump; fluoroquinolone antibiotic; antibiotic efflux; ARO_category "DELETED 36298 " 375 UPDATE mdtH major facilitator superfamily (MFS) antibiotic efflux pump; fluoroquinolone antibiotic; antibiotic efflux; ARO_category "DELETED 35942 " 376 UPDATE lnuC lincosamide nucleotidyltransferase (LNU); lincosamide antibiotic; antibiotic inactivation; ARO_category "DELETED 35964 " 377 UPDATE mepA multidrug and toxic compound extrusion (MATE) transporter; glycylcycline; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35949 " 378 UPDATE TEM-214 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 379 UPDATE OXA-148 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 380 UPDATE CTX-M-147 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 381 UPDATE QnrS1 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 382 UPDATE QnrB61 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 384 UPDATE APH(2'')-IVa APH(2''); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35932 " 385 UPDATE OXA-46 OXA-46-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 387 UPDATE mdtA resistance-nodulation-cell division (RND) antibiotic efflux pump; aminocoumarin antibiotic; antibiotic efflux; ARO_category "DELETED 36250 " 388 UPDATE QnrB71 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 393 UPDATE QnrS5 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 394 UPDATE OXA-130 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 396 UPDATE sul3 sulfonamide resistant sul; sulfonamide antibiotic; antibiotic target replacement; ARO_category "DELETED 36463 " 397 UPDATE OXA-357 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 398 UPDATE TEM-71 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 403 UPDATE dfrA8 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 404 UPDATE OXA-217 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 405 UPDATE OXA-202 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 406 UPDATE ACC-4 ACC beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 407 UPDATE OXA-352 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 408 UPDATE OXA-380 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 410 UPDATE AAC(3)-IIIb AAC(3); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35924 " 411 UPDATE QnrB11 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 412 UPDATE OXA-117 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 413 UPDATE OXA-144 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 414 UPDATE OXA-377 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 415 UPDATE TEM-33 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 416 UPDATE OXA-204 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 417 UPDATE QnrB6 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 418 UPDATE OXA-325 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 420 UPDATE CTX-M-1 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 421 UPDATE TEM-2 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 425 UPDATE TEM-182 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 426 UPDATE aadK ANT(6); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35958 " 429 UPDATE mdsA resistance-nodulation-cell division (RND) antibiotic efflux pump; monobactam; carbapenem; cephalosporin; penicillin beta-lactam; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 36524 " 430 UPDATE OXA-87 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 441 UPDATE OXA-54 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 444 UPDATE AAC(6')-Ib-Suzhou AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35932 " 445 UPDATE TEM-22 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 446 UPDATE catB8 chloramphenicol acetyltransferase (CAT); phenicol antibiotic; antibiotic inactivation; ARO_category "DELETED 36521 " 448 UPDATE dfrG trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 450 UPDATE OXA-51 OXA-51-like beta-lactamase; monobactam; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 452 UPDATE QnrVC4 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 453 UPDATE mtrE resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; antibiotic efflux; ARO_category "DELETED 35925 " 455 UPDATE vanC glycopeptide resistance gene cluster; Van ligase; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 456 UPDATE adeR resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; glycylcycline; tetracycline antibiotic; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35949 " 457 UPDATE OXA-93 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 459 UPDATE CTX-M-94 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 461 UPDATE OXA-13 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 463 UPDATE CTX-M-30 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 466 UPDATE CTX-M-76 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 468 UPDATE Erm(37) Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35925 " 470 UPDATE OXA-4 OXA-1-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 471 UPDATE TEM-151 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 472 UPDATE TEM-128 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 474 UPDATE dfrD trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 475 UPDATE OXA-106 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 476 UPDATE amrB resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; aminoglycoside antibiotic; antibiotic efflux; ARO_category "DELETED 35969 " 477 UPDATE catP chloramphenicol acetyltransferase (CAT); phenicol antibiotic; antibiotic inactivation; ARO_category "DELETED 36521 " 478 UPDATE AAC(3)-IIa AAC(3); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 484 UPDATE QnrB49 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 485 UPDATE TEM-191 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 440 UPDATE MexA resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; fluoroquinolone antibiotic; monobactam; carbapenem; cephalosporin; penicillin beta-lactam; tetracycline antibiotic; peptide antibiotic; aminocoumarin antibiotic; diaminopyrimidine antibiotic; sulfonamide antibiotic; phenicol antibiotic; nonribosomal peptide antibiotics; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 0010004 UPDATED category_aro_cvterm_id with 36005 UPDATED category_aro_name with resistance-nodulation-cell division (RND) antibiotic efflux pump UPDATED category_aro_description with Directed pumping of antibiotic out of a cell to confer resistance. Resistance-nodulation-division (RND) proteins are found in both prokaryotic and eukaryotic cells and have diverse substrate specificities and physiological roles. However, there are relatively few RND transporters and they are secondary transporters, energized not by ATP binding/hydrolysis but by proton movement down the transmembrane electrochemical gradient. UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_accession with 0000000 UPDATED category_aro_cvterm_id with 35919 UPDATED category_aro_name with macrolide antibiotic UPDATED category_aro_description with Macrolides are a group of drugs (typically antibiotics) that have a large macrocyclic lactone ring of 12-16 carbons to which one or more deoxy sugars, usually cladinose and desosamine, may be attached. Macrolides bind to the 50S-subunit of bacterial ribosomes, inhibiting the synthesis of vital proteins. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 0000001 UPDATED category_aro_cvterm_id with 35920 UPDATED category_aro_name with fluoroquinolone antibiotic UPDATED category_aro_description with The fluoroquinolones are a family of synthetic broad-spectrum antibiotics that are 4-quinolone-3-carboxylates. These compounds interact with topoisomerase II (DNA gyrase) to disrupt bacterial DNA replication, damage DNA, and cause cell death. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 0000004 UPDATED category_aro_cvterm_id with 35923 UPDATED category_aro_name with monobactam UPDATED category_aro_description with Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 0000020 UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_name with carbapenem UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 0000032 UPDATED category_aro_cvterm_id with 35951 UPDATED category_aro_name with cephalosporin UPDATED category_aro_description with Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000008 UPDATED category_aro_cvterm_id with 36017 UPDATED category_aro_name with penicillin beta-lactam UPDATED category_aro_description with Penicilins (Penams) are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. Penicillin-like antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000050 UPDATED category_aro_cvterm_id with 36189 UPDATED category_aro_name with tetracycline antibiotic UPDATED category_aro_description with These antibiotics are derived from tetracycline, a polyketide antibiotic that inhibits the 30S subunit of bacterial ribosomes. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000103 UPDATED category_aro_cvterm_id with 36242 UPDATED category_aro_name with aminocoumarin antibiotic UPDATED category_aro_description with Aminocoumarin antibiotics bind DNA gyrase subunit B to inhibit ATP-dependent DNA supercoiling. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000171 UPDATED category_aro_cvterm_id with 36310 UPDATED category_aro_name with diaminopyrimidine antibiotic UPDATED category_aro_description with Diaminopyrimidines are a class of organic compounds containing a pyrimidine ring substituted by two amine groups. They are inhibitors of dihydrofolate reductase, an enzyme critical for DNA synthesis. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000282 UPDATED category_aro_cvterm_id with 36421 UPDATED category_aro_name with sulfonamide antibiotic UPDATED category_aro_description with Sulfonamides are broad spectrum, synthetic antibiotics that contain the sulfonamide group. Sulfonamides inhibit dihydropteroate synthase, which catalyzes the conversion of p-aminobenzoic acid to dihydropteroic acid as part of the tetrahydrofolic acid biosynthetic pathway. Tetrahydrofolic acid is essential for folate synthesis, a precursor of many nucleotides and amino acids. Many sulfamides are taken with trimethoprim, an inhibitor of dihydrofolate reductase, also disturbing the trihydrofolic acid synthesis pathway. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000387 UPDATED category_aro_cvterm_id with 36526 UPDATED category_aro_name with phenicol antibiotic UPDATED category_aro_description with Phenicols are broad spectrum bacteriostatic antibiotics acting on bacterial protein synthesis. More specifically, the phenicols block peptide elongation by binding to the peptidyltansferase centre of the 70S ribosome. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36298 " 458 UPDATE tet(B) major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 402 UPDATE tet(Y) major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 336 UPDATE tlrB conferring tylosin resistance TlrA-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; antibiotic target alteration; model_name; ARO_name; CARD_short_name; ARO_category "UPDATED model_name with tlrB UPDATED ARO_name with tlrB UPDATED CARD_short_name with tlrB UPDATED category_aro_name with TlrA-like 23S rRNA methyltransferase UPDATED category_aro_description with 23S ribosomal RNA methyltransferases modify guanosine 748 (E. coli numbering) to confer resistance to some macrolides and lincosamides. DELETED 36284 " 276 UPDATE tetR major facilitator superfamily (MFS) antibiotic efflux pump; antibiotic efflux regulatory protein; tetracycline antibiotic; antibiotic target alteration; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35968 " 395 UPDATE blaF blaF family beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35981 " 473 UPDATE mphF macrolide phosphotransferase (MPH); macrolide antibiotic; antibiotic inactivation; ARO_category "DELETED 35925 " 486 UPDATE cmlB major facilitator superfamily (MFS) antibiotic efflux pump; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 36524 " 487 UPDATE macB ATP-binding cassette (ABC) antibiotic efflux pump; macrolide antibiotic; antibiotic efflux; ARO_category "DELETED 35925 " 490 UPDATE TEM-188 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 392 UPDATE TUS-1 TUS beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35981 " 442 UPDATE OpmD resistance-nodulation-cell division (RND) antibiotic efflux pump; fluoroquinolone antibiotic; tetracycline antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3000050 UPDATED category_aro_cvterm_id with 36189 UPDATED category_aro_name with tetracycline antibiotic UPDATED category_aro_description with These antibiotics are derived from tetracycline, a polyketide antibiotic that inhibits the 30S subunit of bacterial ribosomes. UPDATED category_aro_class_name with Drug Class DELETED 35963 " 493 UPDATE TEM-84 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 409 UPDATE vanR gene in vanL cluster glycopeptide resistance gene cluster; vanR; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 389 UPDATE tet(W) tetracycline-resistant ribosomal protection protein; tetracycline antibiotic; antibiotic target protection; ARO_category "DELETED 35968 " 497 UPDATE OXA-79 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 498 UPDATE QnrB17 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 500 UPDATE OXA-164 OXA-58-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 501 UPDATE AAC(3)-VIIIa AAC(3); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35924 " 502 UPDATE aadA17 ANT(3''); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35957 " 503 UPDATE CTX-M-69 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 504 UPDATE TEM-52 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 507 UPDATE rosB major facilitator superfamily (MFS) antibiotic efflux pump; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic efflux; model_param; model_sequences; ARO_category "UPDATED param_value with 1000 UPDATED accession with HDL8274934.1 UPDATED sequence with MHHSTPLITTIVGGLVLAFLLGSLAHRLRISPLVGYLAAGVLAGPFTPGFVADTSLAPELAEIGVILLMFGVGLHFSLKDLLAVKAIAIPGAVAQIAVATLLGMGLSHLLGWDLMTGFVFGLCLSTASTVVLLRALEERQLIDSQRGQIAIGWLIVEDLAMVLTLVLLPAFAGVMGNETTSLSQLFTELAITIGKVIAFITLMIVVGRRLVPWILAKTASTGSRELFTLAVLVLALGIAYGAVGLFDVSFALGAFFAGMVLNESELSHRAAQDTLPLRDAFAVLFFVSVGMLFDPMILLREPLAVLASLAIIIFGKSAAAFILVRMFGHSKRTALTISVSLAQIGEFAFILAGLGISLGLMSEHGRNLVLAGAILSIMLNPLLFTLLDRYLAKNETMEDLILEEAVEEEKQIPVNLCNHALLVGYGRVGSLLGAKLHAEGIPLVVIENSRPRVEALREQGINAVLGNAASADIMSLARLDCARWLLLTIPNGYEAGEIVASARIKRPDLEIIARAHYDDEVVYISDRGANQVVMGEREIANSMLNMLKIETLTEEDKRPLCPI UPDATED accession with DANNBB010000192.1 UPDATED fmin with 2642 UPDATED fmax with 4334 UPDATED strand with - UPDATED sequence with ATGCACCACTCAACACCCTTAATTACCACGATCGTCGGAGGCCTTGTTCTCGCCTTCCTCTTGGGCTCCTTGGCTCACCGCCTGCGCATCTCACCACTGGTGGGGTACCTTGCCGCAGGGGTGCTGGCCGGGCCATTTACGCCAGGTTTCGTTGCTGATACCTCATTAGCGCCAGAACTGGCTGAAATTGGTGTTATCTTGTTGATGTTTGGTGTCGGACTTCACTTCTCACTTAAAGACCTCCTCGCAGTAAAAGCCATCGCCATACCCGGTGCTGTAGCACAAATTGCCGTTGCCACCTTACTCGGAATGGGACTGTCTCATTTATTAGGCTGGGATTTGATGACAGGTTTTGTCTTCGGTCTTTGTCTATCAACAGCAAGTACCGTGGTATTACTGCGAGCTTTAGAAGAACGGCAACTCATAGATAGCCAGCGGGGGCAAATTGCTATCGGCTGGCTGATTGTCGAAGATTTGGCGATGGTACTCACATTGGTGCTGTTACCAGCCTTTGCCGGCGTGATGGGTAACGAAACCACCAGTCTCAGCCAGTTATTCACTGAATTAGCAATAACCATCGGTAAAGTCATTGCCTTCATTACGCTGATGATTGTTGTCGGTCGCCGTTTGGTCCCCTGGATACTGGCTAAAACCGCCAGTACCGGTTCCCGTGAGCTATTTACCTTGGCAGTGCTGGTATTAGCACTTGGTATTGCTTACGGCGCTGTAGGGCTGTTCGATGTATCCTTTGCTCTCGGTGCATTCTTCGCAGGAATGGTATTGAATGAATCAGAGCTCAGCCACCGTGCGGCGCAAGATACCTTACCGCTACGTGATGCATTTGCCGTACTGTTCTTCGTTTCAGTTGGGATGTTGTTCGACCCAATGATTTTGCTACGTGAACCATTAGCTGTACTGGCTTCACTAGCTATCATTATCTTCGGCAAATCAGCCGCAGCGTTTATATTAGTGCGCATGTTTGGTCACTCAAAACGCACAGCACTCACCATTTCTGTCAGCCTGGCGCAAATCGGTGAATTTGCCTTTATTCTCGCCGGGCTTGGGATTTCTCTCGGTTTAATGTCTGAGCATGGCCGTAATCTAGTGCTGGCGGGCGCAATTTTATCAATTATGCTCAACCCGCTACTGTTTACATTATTGGATCGCTATTTGGCTAAAAACGAGACTATGGAAGATCTGATTCTGGAAGAGGCCGTCGAAGAGGAAAAGCAGATCCCGGTAAATTTGTGCAATCATGCACTATTAGTCGGTTATGGTCGGGTGGGGAGTTTATTAGGTGCAAAATTGCACGCGGAAGGTATTCCATTAGTGGTCATTGAGAACTCTCGACCAAGAGTTGAGGCGCTACGTGAACAAGGCATTAATGCGGTATTAGGCAATGCTGCAAGTGCAGATATTATGTCGCTGGCTCGTTTGGATTGTGCCCGCTGGTTATTACTGACCATACCGAATGGCTACGAAGCTGGGGAAATTGTCGCTTCCGCCAGAATTAAACGGCCAGATCTTGAGATAATTGCTCGCGCGCATTATGACGACGAAGTGGTTTATATCTCGGATCGTGGCGCGAACCAGGTTGTGATGGGCGAACGTGAAATTGCCAACAGTATGCTTAATATGTTGAAGATAGAAACGCTGACCGAAGAAGACAAACGCCCGCTTTGCCCAATTTAA UPDATED partial with 0 UPDATED NCBI_taxonomy_cvterm_id with 40164 UPDATED NCBI_taxonomy_name with Yersinia enterocolitica UPDATED NCBI_taxonomy_id with 630 DELETED 4555 UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36593 " 508 UPDATE tetA(P) major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 510 UPDATE CTX-M-9 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 511 UPDATE dfrA3 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 512 UPDATE CTX-M-82 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 517 UPDATE QnrD2 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 521 UPDATE OXA-386 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 523 UPDATE OXA-75 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 524 UPDATE dfrA25 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 532 UPDATE CTX-M-47 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 536 UPDATE TEM-95 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 537 UPDATE OXA-120 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 539 UPDATE QnrB59 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 540 UPDATE emrY major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 541 UPDATE TEM-133 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 542 UPDATE adeH resistance-nodulation-cell division (RND) antibiotic efflux pump; fluoroquinolone antibiotic; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 543 UPDATE TEM-106 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 544 UPDATE AAC(6')-Is AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 547 UPDATE arr-5 rifampin ADP-ribosyltransferase (Arr); rifamycin antibiotic; antibiotic inactivation; ARO_category "DELETED 36308 " 548 UPDATE QnrB3 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 549 UPDATE TEM-107 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 551 UPDATE CTX-M-117 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 552 UPDATE QnrB28 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 554 UPDATE OXA-163 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 555 UPDATE OXA-133 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 558 UPDATE qacB major facilitator superfamily (MFS) antibiotic efflux pump; fluoroquinolone antibiotic; antibiotic efflux; ARO_category "DELETED 36298 " 560 UPDATE OXA-77 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 562 UPDATE TEM-187 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 566 UPDATE OXA-32 OXA-2-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 567 UPDATE CTX-M-41 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 568 UPDATE CTX-M-20 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 569 UPDATE OXA-228 OXA-229-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 571 UPDATE clbA Cfr-like 23S rRNA methyltransferase; lincosamide antibiotic; streptogramin antibiotic; oxazolidinone antibiotic; phenicol antibiotic; pleuromutilin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Cfr-like 23S rRNA methyltransferase DELETED 35964 " 572 UPDATE OXA-137 OXA-63-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 573 UPDATE OXA-136 OXA-63-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 574 UPDATE AAC(6')-Ia AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 575 UPDATE AAC(3)-Ib AAC(3); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35922 " 577 UPDATE QnrB65 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 579 UPDATE vgaA vga-type ABC-F protein; lincosamide antibiotic; streptogramin antibiotic; pleuromutilin antibiotic; antibiotic target protection; ARO_category "DELETED 35983 " 580 UPDATE TEM-110 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 581 UPDATE QnrB19 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 584 UPDATE aadA21 ANT(3''); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35957 " 587 UPDATE TEM-73 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 589 UPDATE TEM-145 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 591 UPDATE CTX-M-122 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 592 UPDATE lmrB ATP-binding cassette (ABC) antibiotic efflux pump; lincosamide antibiotic; nucleoside antibiotic; antibiotic efflux; ARO_category "DELETED 35964 " 593 UPDATE abeS small multidrug resistance (SMR) antibiotic efflux pump; macrolide antibiotic; aminocoumarin antibiotic; antibiotic efflux; ARO_category "DELETED 35925 " 594 UPDATE QnrB41 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 598 UPDATE dfrA16 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 600 UPDATE CMY-2 CMY beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35927 " 601 UPDATE dfrA20 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 603 UPDATE mdtG major facilitator superfamily (MFS) antibiotic efflux pump; phosphonic acid antibiotic; antibiotic efflux; ARO_category "DELETED 35944 " 604 UPDATE OXA-385 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 605 UPDATE OXA-96 OXA-58-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 606 UPDATE IMI-2 IMI beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 0000032 UPDATED category_aro_cvterm_id with 35951 UPDATED category_aro_name with cephalosporin UPDATED category_aro_description with Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000008 UPDATED category_aro_cvterm_id with 36017 UPDATED category_aro_name with penicillin beta-lactam UPDATED category_aro_description with Penicilins (Penams) are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. Penicillin-like antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_class_name with Drug Class " 607 UPDATE TEM-201 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 608 UPDATE OXA-361 OXA-134-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 609 UPDATE emrK major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 611 UPDATE OXA-328 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 615 UPDATE OXA-211 OXA-211-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 617 UPDATE OXA-147 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 618 UPDATE emeA multidrug and toxic compound extrusion (MATE) transporter; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 35963 " 620 UPDATE OXA-320 OXA-1-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 621 UPDATE ErmF Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35925 " 623 UPDATE OXA-68 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 625 UPDATE QnrB46 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 628 UPDATE catB10 chloramphenicol acetyltransferase (CAT); phenicol antibiotic; antibiotic inactivation; ARO_category "DELETED 36521 " 630 UPDATE adeJ resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; fluoroquinolone antibiotic; lincosamide antibiotic; carbapenem; cephalosporin; penicillin beta-lactam; tetracycline antibiotic; rifamycin antibiotic; diaminopyrimidine antibiotic; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 631 UPDATE TEM-21 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 633 UPDATE OXA-355 OXA-229-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 634 UPDATE smeF resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; fluoroquinolone antibiotic; tetracycline antibiotic; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 635 UPDATE OXA-332 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 642 UPDATE aadA25 ANT(3''); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35957 " 645 UPDATE mecR1 gene modulating beta-lactam resistance; PBP2-like beta-lactam resistant peptidoglycan transpeptidase; cephalosporin; penicillin beta-lactam; antibiotic target replacement; ARO_category "UPDATED category_aro_accession with 3000100 UPDATED category_aro_cvterm_id with 36239 UPDATED category_aro_name with gene modulating beta-lactam resistance UPDATED category_aro_description with Genes that directly or indirectly modulate beta-lactam resistance. UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_accession with 3009312 UPDATED category_aro_cvterm_id with 48160 UPDATED category_aro_name with PBP2-like beta-lactam resistant peptidoglycan transpeptidase UPDATED category_aro_description with Peptidoglycan transpeptidase proteins involved in bacterial cell wall formation and which have decreased susceptibility to some beta-lactam antibiotics. These alternative transpeptidases are found in certain organisms, like Staphylococcus aureus, and have lower affinity for penicillin-like antibiotics, such as methicillin. In these organisms, these proteins do not bind to the beta-lactam ring and therefore transpeptidase activity continues in the presence of beta-lactams, thereby conferring resistance to these drugs. These proteins are commonly clinically associated with methicillin-resistant Staphylococcus aureus (MRSA). UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_accession with 0000032 UPDATED category_aro_cvterm_id with 35951 UPDATED category_aro_name with cephalosporin UPDATED category_aro_description with Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class DELETED 37589 " 646 UPDATE OXA-349 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 647 UPDATE TEM-89 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 649 UPDATE OXA-115 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 650 UPDATE aadA ANT(3''); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35957 " 652 UPDATE tcr3 major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 531 UPDATE SAT-3 streptothricin acetyltransferase (SAT); nucleoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35931 " 640 UPDATE tet(31) major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 516 UPDATE eptA pmr phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36593 " 492 UPDATE Clostridium butyricum catB chloramphenicol acetyltransferase (CAT); phenicol antibiotic; antibiotic inactivation; ARO_category "DELETED 36521 " 653 UPDATE AAC(3)-VIIa AAC(3); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 37001 " 654 UPDATE dfrA26 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 655 UPDATE OXA-243 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 656 UPDATE OXA-219 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 520 UPDATE AcrS resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; fluoroquinolone antibiotic; cephalosporin; glycylcycline; penicillin beta-lactam; tetracycline antibiotic; rifamycin antibiotic; phenicol antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35949 " 556 UPDATE vanY gene in vanB cluster vanY; glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 559 UPDATE vanXY gene in vanE cluster glycopeptide resistance gene cluster; vanXY; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 534 UPDATE vanV gene in vanB cluster glycopeptide resistance gene cluster; vanV; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 659 UPDATE AAC(6')-29b AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 662 UPDATE TEM-162 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 665 UPDATE TEM-10 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 666 UPDATE CTX-M-34 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 668 UPDATE CTX-M-65 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 671 UPDATE CTX-M-137 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 674 UPDATE OXA-15 OXA-2-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 675 UPDATE OXA-25 OXA-24-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 676 UPDATE AAC(6')-Ih AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 677 UPDATE OXA-171 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 678 UPDATE PDC-10 PDC beta-lactamase; monobactam; carbapenem; cephalosporin; antibiotic inactivation; ARO_category "DELETED 35977 " 681 UPDATE TEM-120 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 682 UPDATE QnrS4 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 685 UPDATE OXA-239 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 686 UPDATE OXA-162 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 687 UPDATE APH(3')-Vc APH(3'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35924 " 689 UPDATE CTX-M-123 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 690 UPDATE OXA-347 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 692 UPDATE TEM-159 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 693 UPDATE OXA-22 OXA-22-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 694 UPDATE CTX-M-40 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 696 UPDATE cfrA Cfr-like 23S rRNA methyltransferase; lincosamide antibiotic; streptogramin antibiotic; oxazolidinone antibiotic; phenicol antibiotic; pleuromutilin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Cfr-like 23S rRNA methyltransferase DELETED 35964 " 697 UPDATE Erm(42) Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35925 " 698 UPDATE TEM-205 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 699 UPDATE QnrS9 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 702 UPDATE CTX-M-98 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 703 UPDATE cmlv chloramphenicol phosphotransferase; phenicol antibiotic; antibiotic inactivation; ARO_category "DELETED 36524 " 706 UPDATE APH(7'')-Ia APH(7''); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 36353 " 708 UPDATE CTX-M-49 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 709 UPDATE TEM-213 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 710 UPDATE dfrB6 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 712 UPDATE catB2 chloramphenicol acetyltransferase (CAT); phenicol antibiotic; antibiotic inactivation; ARO_category "DELETED 36521 " 713 UPDATE CTX-M-81 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 714 UPDATE dfrB1 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 715 UPDATE PDC-3 PDC beta-lactamase; monobactam; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35927 " 716 UPDATE QnrB32 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 717 UPDATE CTX-M-100 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 721 UPDATE OXA-28 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 724 UPDATE AAC(6')-Ij AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 727 UPDATE ErmS Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35964 " 728 UPDATE TEM-192 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 729 UPDATE CTX-M-8 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 730 UPDATE AAC(6')-IIc AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 732 UPDATE OXA-237 OXA-134-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 735 UPDATE TEM-30 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35981 " 736 UPDATE arr-7 rifampin ADP-ribosyltransferase (Arr); rifamycin antibiotic; antibiotic inactivation; ARO_category "DELETED 36308 " 738 UPDATE AAC(6')-Iae AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 740 UPDATE QnrB21 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 741 UPDATE CfxA CfxA beta-lactamase; cephalosporin; antibiotic inactivation; ARO_category "DELETED 35927 " 742 UPDATE AAC(3)-Id AAC(3); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35922 " 743 UPDATE arr-3 rifampin ADP-ribosyltransferase (Arr); rifamycin antibiotic; antibiotic inactivation; ARO_category "DELETED 36308 " 746 UPDATE AAC(2')-Ib AAC(2'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 747 UPDATE QnrA4 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 748 UPDATE cmeB resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; fluoroquinolone antibiotic; cephalosporin; fusidane antibiotic; antibiotic efflux; ARO_category "DELETED 35925 " 751 UPDATE TEM-217 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 754 UPDATE CTX-M-48 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 758 UPDATE OXA-198 OXA-198-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 760 UPDATE TEM-6 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 762 UPDATE CTX-M-55 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class DELETED 35977 " 765 UPDATE QnrB7 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 767 UPDATE OXA-207 OXA-24-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 783 UPDATE NDM-1 NDM beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35987 " 779 UPDATE OXA-350 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 781 UPDATE QnrB25 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 782 UPDATE OXA-63 OXA-63-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 784 UPDATE AAC(6')-Iv AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 787 UPDATE dfrA23 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 795 UPDATE OXA-324 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 796 UPDATE iri rifampin monooxygenase; rifamycin antibiotic; antibiotic inactivation; ARO_category "DELETED 36308 " 797 UPDATE TEM-55 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 798 UPDATE cmeC resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; fluoroquinolone antibiotic; cephalosporin; fusidane antibiotic; antibiotic efflux; ARO_category "DELETED 35925 " 799 UPDATE CTX-M-31 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 800 UPDATE CTX-M-87 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 801 UPDATE mfpA quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 802 UPDATE QnrA3 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 804 UPDATE tetB(P) tetracycline-resistant ribosomal protection protein; tetracycline antibiotic; antibiotic target protection; ARO_category "DELETED 35968 " 808 UPDATE TEM-171 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 809 UPDATE lnuB lincosamide nucleotidyltransferase (LNU); lincosamide antibiotic; antibiotic inactivation; ARO_category "DELETED 35964 " 810 UPDATE mecC PBP2-like beta-lactam resistant peptidoglycan transpeptidase; penicillin beta-lactam; antibiotic target replacement; model_sequences; ARO_description; ARO_category "UPDATED accession with WP_000725529.1 UPDATED sequence with MKKIYISVLVLLLIMIIITWLFKDDDIEKTISSIEKGNYNEVYKNSSEKSKLAYGEEEIVDRNKKIYKDLSVNNLKITNHEIKKTGKDKKQVDVKYNIYTKYGTIRRNTQLNFIYEDKHWKLDWRPDVIVPGLKNGQKINIETLKSERGKIKDRNGIELAKTGNTYEIGIVPNKTPKEKYDDIARDLQIDTKAITNKVNQKWVQPDSFVPIKKINKQDEYIDKLIKSYNLQINTIKSRVYPLNEATVHLLGYVGPINSDELKSKQFRNYSKNTVIGKKGLERLYDKQLQNTDGFKVSIANTYDNKPLDTLLEKKAENGKDLHLTIDARVQESIYKHMKNDDGSGTALQPKTGEILALVSTPSYDVYPFMNGLSNNDYRKLTNNKKEPLLNKFQITTSPGSTQKILTSIIALKENKLDKNTNFDIYGKGWQKDASWGNYNITRFKVVDGNIDLKQAIESSDNIFFARIALALGAKKFEQGMQDLGIGENIPSDYPFYKAQISNSNLKNEILLADSGYGQGEILVNPIQILSIYSALENNGNIQNPHVLRKTKSQIWKKDIIPKKDIDILTNGMERVVNKTHRDDIYKNYARIIGKSGTAELKMNQGETGRQIGWFVSYNKNNPNMLMAINVKDVQNKGMASYNATISGKVYDDLYDNGKTQFDIDQ UPDATED accession with NG_047955.1 UPDATED fmin with 100 UPDATED fmax with 2098 UPDATED strand with + UPDATED sequence with ATGAAAAAAATTTATATTAGTGTGCTAGTTCTTTTACTAATTATGATTATAATAACTTGGTTATTCAAAGATGACGATATTGAGAAAACAATTAGTTCTATTGAAAAAGGAAACTATAACGAAGTATATAAAAATAGTTCAGAAAAATCTAAACTGGCATATGGAGAAGAAGAAATTGTAGATAGGAATAAAAAAATTTACAAAGATTTAAGTGTCAATAACTTAAAAATTACTAATCATGAAATTAAAAAAACTGGAAAAGATAAAAAGCAAGTTGATGTTAAATATAACATATATACAAAATATGGAACTATACGACGTAATACACAATTAAACTTTATTTATGAAGATAAGCATTGGAAATTAGATTGGAGACCAGACGTAATAGTACCTGGTTTGAAAAATGGACAGAAAATTAATATAGAAACATTAAAATCAGAGCGAGGCAAAATAAAAGATAGAAATGGTATAGAATTAGCTAAAACTGGAAATACATATGAAATCGGTATTGTCCCTAACAAAACACCCAAAGAAAAATATGATGATATTGCTCGTGACTTACAAATTGATACAAAAGCTATAACCAATAAAGTTAATCAAAAATGGGTTCAGCCAGATTCATTTGTACCAATTAAAAAGATAAATAAACAAGATGAATATATAGACAAATTAATTAAATCATACAATTTACAAATAAACACTATAAAAAGCCGTGTTTATCCATTGAACGAAGCAACAGTACACCTTTTAGGTTATGTGGGTCCAATTAATTCTGACGAGTTAAAAAGTAAGCAATTTAGAAACTATAGCAAAAATACTGTTATTGGAAAAAAAGGCTTAGAACGCCTCTATGATAAACAATTGCAAAACACTGATGGTTTTAAGGTATCCATTGCAAATACTTATGACAATAAACCTTTAGACACATTATTGGAGAAAAAGGCTGAAAACGGAAAAGATCTTCATTTAACTATAGATGCTAGAGTACAAGAAAGTATTTATAAACATATGAAAAATGACGATGGATCTGGTACAGCATTACAACCAAAAACTGGAGAAATTTTAGCTTTGGTAAGTACCCCATCGTACGATGTTTATCCATTCATGAATGGATTAAGCAATAATGACTACCGTAAATTAACTAACAATAAAAAAGAGCCTTTGCTCAACAAATTTCAAATCACTACATCACCAGGTTCAACCCAAAAAATATTAACATCTATTATAGCCTTAAAAGAAAATAAACTAGACAAAAATACTAATTTTGATATTTATGGTAAGGGTTGGCAAAAAGATGCATCATGGGGTAATTATAATATCACAAGATTTAAAGTAGTAGACGGCAATATCGATTTAAAGCAAGCAATAGAATCATCAGACAACATATTTTTTGCCCGCATTGCATTAGCATTAGGAGCCAAAAAATTTGAGCAAGGTATGCAAGATTTGGGAATCGGTGAAAATATCCCGAGTGATTATCCCTTTTATAAAGCACAAATCTCAAATAGTAATTTAAAAAATGAAATATTATTAGCAGATTCAGGATATGGCCAAGGCGAGATACTAGTAAACCCTATACAAATTTTATCAATATACAGTGCTTTAGAAAATAACGGAAATATACAAAATCCTCATGTTTTACGTAAAACAAAATCTCAAATATGGAAAAAAGATATTATACCTAAAAAAGACATAGATATATTAACTAATGGTATGGAACGTGTAGTTAATAAAACACATAGGGATGATATATACAAAAATTATGCCCGAATTATTGGTAAATCTGGCACAGCAGAATTAAAAATGAATCAAGGGGAAACTGGAAGACAAATAGGTTGGTTTGTTTCATATAATAAAAATAATCCTAATATGTTAATGGCGATTAATGTTAAAGACGTTCAAAATAAAGGGATGGCCAGCTATAATGCTACTATATCTGGAAAAGTTTATGATGATTTGTATGATAATGGAAAAACTCAATTTGATATAGATCAGTAA UPDATED partial with 0 UPDATED NCBI_taxonomy_cvterm_id with 35508 UPDATED NCBI_taxonomy_name with Staphylococcus aureus UPDATED NCBI_taxonomy_id with 1280 DELETED 5248 UPDATED ARO_description with mecC encodes an alternative PBP2a protein involved in bacterial cell wall formation. These proteins are acquired by lateral gene transfer and commonly associated with methicillin-resistant Staphylococcus aureus (MRSA). These proteins have lower affinity for penicillin-like antibiotics and therefore are able to perform peptidoglycan synthesis in the presence of beta-lactams. UPDATED category_aro_accession with 3009312 UPDATED category_aro_cvterm_id with 48160 UPDATED category_aro_name with PBP2-like beta-lactam resistant peptidoglycan transpeptidase UPDATED category_aro_description with Peptidoglycan transpeptidase proteins involved in bacterial cell wall formation and which have decreased susceptibility to some beta-lactam antibiotics. These alternative transpeptidases are found in certain organisms, like Staphylococcus aureus, and have lower affinity for penicillin-like antibiotics, such as methicillin. In these organisms, these proteins do not bind to the beta-lactam ring and therefore transpeptidase activity continues in the presence of beta-lactams, thereby conferring resistance to these drugs. These proteins are commonly clinically associated with methicillin-resistant Staphylococcus aureus (MRSA). UPDATED category_aro_class_name with AMR Gene Family DELETED 37589 " 632 UPDATE basR pmr phosphoethanolamine transferase; antibiotic efflux regulatory protein; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36593 " 805 UPDATE MexC resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; fluoroquinolone antibiotic; aminoglycoside antibiotic; cephalosporin; penicillin beta-lactam; tetracycline antibiotic; aminocoumarin antibiotic; diaminopyrimidine antibiotic; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 35925 " 704 UPDATE OprJ resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; fluoroquinolone antibiotic; aminoglycoside antibiotic; cephalosporin; penicillin beta-lactam; tetracycline antibiotic; aminocoumarin antibiotic; diaminopyrimidine antibiotic; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 35925 " 811 UPDATE TEM-26 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 813 UPDATE OXA-216 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 814 UPDATE TEM-113 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 722 UPDATE vanR gene in vanA cluster glycopeptide resistance gene cluster; vanR; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 816 UPDATE OXA-3 OXA-2-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 817 UPDATE CTX-M-158 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 819 UPDATE CTX-M-68 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 820 UPDATE mdtB resistance-nodulation-cell division (RND) antibiotic efflux pump; aminocoumarin antibiotic; antibiotic efflux; ARO_category "DELETED 36250 " 822 UPDATE QnrD1 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 824 UPDATE vanD glycopeptide resistance gene cluster; Van ligase; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 786 UPDATE vanH gene in vanO cluster vanH; glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 774 UPDATE tet(37) tetracycline inactivation enzyme; tetracycline antibiotic; antibiotic inactivation; ARO_category "DELETED 35968 " 776 UPDATE tet(X) tetracycline inactivation enzyme; glycylcycline; tetracycline antibiotic; antibiotic inactivation; ARO_category "DELETED 35949 " 827 UPDATE QnrB55 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 828 UPDATE TEM-83 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 834 UPDATE FosA3 fosfomycin thiol transferase; phosphonic acid antibiotic; antibiotic inactivation; ARO_category "DELETED 35944 " 835 UPDATE APH(3')-Ib APH(3'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35924 " 836 UPDATE TEM-68 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 837 UPDATE vatH streptogramin vat acetyltransferase; streptogramin antibiotic; antibiotic inactivation; ARO_category "DELETED 37013 " 838 UPDATE CTX-M-102 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 841 UPDATE CTX-M-14 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 843 UPDATE QnrB14 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 845 UPDATE TEM-163 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 847 UPDATE CTX-M-108 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 849 UPDATE OXA-138 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 850 UPDATE OXA-26 OXA-24-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 852 UPDATE QnrB62 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 853 UPDATE OXA-160 OXA-24-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 855 UPDATE TEM-142 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 856 UPDATE mepR multidrug and toxic compound extrusion (MATE) transporter; antibiotic efflux regulatory protein; glycylcycline; tetracycline antibiotic; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35949 " 3302 UPDATE tet(56) tetracycline inactivation enzyme; tetracycline antibiotic; antibiotic inactivation; ARO_category "DELETED 35968 " 860 UPDATE TEM-42 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 861 UPDATE OXA-215 OXA-214-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 865 UPDATE OXA-244 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 866 UPDATE adeB resistance-nodulation-cell division (RND) antibiotic efflux pump; glycylcycline; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35949 " 867 UPDATE OXA-175 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 869 UPDATE CRP resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; macrolide antibiotic; fluoroquinolone antibiotic; penicillin beta-lactam; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35925 " 872 UPDATE vatC streptogramin vat acetyltransferase; streptogramin antibiotic; antibiotic inactivation; ARO_category "DELETED 37013 " 875 UPDATE dfrA19 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 876 UPDATE smeE resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; fluoroquinolone antibiotic; tetracycline antibiotic; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 878 UPDATE CTX-M-142 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 879 UPDATE TEM-185 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 880 UPDATE APH(6)-Ib APH(6); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35958 " 881 UPDATE ErmC Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35925 " 884 UPDATE CTX-M-99 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 885 UPDATE TEM-63 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 888 UPDATE Erm(36) Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35925 " 891 UPDATE QnrB37 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 892 UPDATE APH(6)-Ic APH(6); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35958 " 896 UPDATE CTX-M-131 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 897 UPDATE OXA-383 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 899 UPDATE OXA-94 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 902 UPDATE OXA-92 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 903 UPDATE APH(2'')-Ig APH(2''); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35932 " 904 UPDATE rmtB 16S rRNA methyltransferase (G1405); aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35926 " 905 UPDATE CTX-M-93 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 907 UPDATE fexA major facilitator superfamily (MFS) antibiotic efflux pump; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 36524 " 908 UPDATE CTX-M-139 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 909 UPDATE OXA-5 OXA-5-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 914 UPDATE ANT(6)-Ia ANT(6); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35958 " 916 UPDATE OXA-36 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 918 UPDATE TEM-49 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 920 UPDATE TEM-152 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 925 UPDATE AAC(3)-IIb AAC(3); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 927 UPDATE OXA-381 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 928 UPDATE carA Miscellaneous ABC-F subfamily ATP-binding cassette ribosomal protection proteins; macrolide antibiotic; antibiotic target protection; ARO_category "DELETED 37627 " 948 UPDATE mecI gene modulating beta-lactam resistance; PBP2-like beta-lactam resistant peptidoglycan transpeptidase; cephalosporin; penicillin beta-lactam; antibiotic target replacement; model_name; model_sequences; ARO_name; CARD_short_name; ARO_description; ARO_category "UPDATED model_name with mecA-type mecI UPDATED accession with WP_000369216.1 UPDATED sequence with MDNKTYEISSAEWEVMNIIWMKKYASTNNIIEEIQMQKDWSPKTIRTLITRLYKKGFIDRKKDNKIFQYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNFVEKEDLSQDEIEELRNILNKK UPDATED accession with NG_047956.1 UPDATED fmin with 100 UPDATED fmax with 472 UPDATED strand with + UPDATED sequence with ATGGATAATAAAACGTATGAAATATCATCTGCAGAATGGGAAGTTATGAATATCATTTGGATGAAAAAATATGCAAGTACGAATAATATAATAGAAGAAATACAAATGCAAAAGGACTGGAGTCCAAAAACCATTCGTACACTTATAACGAGATTGTATAAAAAGGGATTTATAGATCGTAAAAAAGACAATAAAATTTTTCAATATTACTCTCTTGTAGAAGAAAGTGATATAAAATATAAAACATCTAAAAACTTTATCAATAAAGTATACAAAGGCGGTTTCAATTCACTTGTCTTAAACTTTGTAGAAAAAGAAGATCTATCACAAGATGAAATAGAAGAATTGAGAAATATATTGAATAAAAAATAA UPDATED partial with 0 UPDATED NCBI_taxonomy_cvterm_id with 35543 UPDATED NCBI_taxonomy_name with Staphylococcus aureus subsp. aureus str. JKD6008 UPDATED NCBI_taxonomy_id with 546342 DELETED 4247 UPDATED ARO_name with mecA-type mecI UPDATED CARD_short_name with mecA-type_mecI UPDATED ARO_description with A mecA-type mecI repressor gene which mediates production of PBP2 by mecA. In methicillin-resistant Staphylococci possessing the mecA gene, mecI represses the expression of mecC thereby restoring or increasing susceptibility to methicillin and beta-lactam antibiotics. UPDATED category_aro_accession with 3000100 UPDATED category_aro_cvterm_id with 36239 UPDATED category_aro_name with gene modulating beta-lactam resistance UPDATED category_aro_description with Genes that directly or indirectly modulate beta-lactam resistance. UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_accession with 3009312 UPDATED category_aro_cvterm_id with 48160 UPDATED category_aro_name with PBP2-like beta-lactam resistant peptidoglycan transpeptidase UPDATED category_aro_description with Peptidoglycan transpeptidase proteins involved in bacterial cell wall formation and which have decreased susceptibility to some beta-lactam antibiotics. These alternative transpeptidases are found in certain organisms, like Staphylococcus aureus, and have lower affinity for penicillin-like antibiotics, such as methicillin. In these organisms, these proteins do not bind to the beta-lactam ring and therefore transpeptidase activity continues in the presence of beta-lactams, thereby conferring resistance to these drugs. These proteins are commonly clinically associated with methicillin-resistant Staphylococcus aureus (MRSA). UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_accession with 0000032 UPDATED category_aro_cvterm_id with 35951 UPDATED category_aro_name with cephalosporin UPDATED category_aro_description with Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class DELETED 37589 " 931 UPDATE OXA-316 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 935 UPDATE OXA-314 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 937 UPDATE OXA-242 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 938 UPDATE QnrB70 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 939 UPDATE CTX-M-113 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 940 UPDATE TEM-125 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 942 UPDATE OXA-104 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 944 UPDATE bcrB ATP-binding cassette (ABC) antibiotic efflux pump; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35959 " 946 UPDATE QnrB48 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 947 UPDATE OXA-100 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 949 UPDATE CTX-M-77 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 950 UPDATE ErmX Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35925 " 952 UPDATE sul2 sulfonamide resistant sul; sulfonamide antibiotic; antibiotic target replacement; ARO_category "DELETED 36463 " 954 UPDATE APH(3')-IIb APH(3'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35924 " 956 UPDATE TEM-88 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 958 UPDATE OXA-418 OXA-229-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 959 UPDATE OXA-64 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 960 UPDATE TEM-137 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 962 UPDATE OXA-356 OXA-229-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 964 UPDATE OXA-129 OXA-5-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 965 UPDATE OXA-333 OXA-211-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 967 UPDATE AAC(6')-Isa AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 870 UPDATE otr(B) major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 910 UPDATE rphA rifampin phosphotransferase; rifamycin antibiotic; antibiotic inactivation; ARO_category "DELETED 36308 " 945 UPDATE tet(40) major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 900 UPDATE tet(C) major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 957 UPDATE tet(G) major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 842 UPDATE ugd pmr phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36593 " 971 UPDATE cmlA4 major facilitator superfamily (MFS) antibiotic efflux pump; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 36524 " 973 UPDATE OXA-378 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 974 UPDATE lmrC Miscellaneous ABC-F subfamily ATP-binding cassette ribosomal protection proteins; lincosamide antibiotic; antibiotic target protection; ARO_category "DELETED 35964 " 975 UPDATE QnrB1 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 976 UPDATE CTX-M-61 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 966 UPDATE vanS gene in vanC cluster vanS; glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 977 UPDATE OXA-112 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 978 UPDATE OXA-134 OXA-134-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 979 UPDATE TEM-96 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 980 UPDATE y56 beta-lactamase BlaA beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 40523 " 981 UPDATE OXA-86 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 982 UPDATE TEM-153 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 985 UPDATE ErmA Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35925 " 987 UPDATE CTX-M-4 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 989 UPDATE ErmG Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35925 " 991 UPDATE EreA macrolide esterase; macrolide antibiotic; antibiotic inactivation; ARO_category "DELETED 35925 " 993 UPDATE AAC(6')-Ib9 AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35932 " 986 UPDATE baeS resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; aminoglycoside antibiotic; aminocoumarin antibiotic; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35924 " 1000 UPDATE AAC(6')-Ib-Hangzhou AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35932 " 1002 UPDATE AAC(6')-Ib4 AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35932 " 1003 UPDATE OXA-18 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 1010 UPDATE TEM-209 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1011 UPDATE TEM-29 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1013 UPDATE APH(2'')-IIIa APH(2''); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35932 " 1015 UPDATE evgA major facilitator superfamily (MFS) antibiotic efflux pump; resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; macrolide antibiotic; fluoroquinolone antibiotic; penicillin beta-lactam; tetracycline antibiotic; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35925 " 1016 UPDATE OXA-255 OXA-143-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1017 UPDATE CTX-M-86 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1018 UPDATE APH(3')-IIc APH(3'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35924 " 1020 UPDATE OXA-241 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1021 UPDATE CTX-M-54 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1022 UPDATE TEM-28 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1024 UPDATE AAC(6')-Ib-SK AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35932 " 1025 UPDATE TEM-136 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1028 UPDATE SHV-1 SHV beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36981 " 1031 UPDATE APH(6)-Id APH(6); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35958 " 1032 UPDATE OXA-365 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1034 UPDATE QnrA7 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 1037 UPDATE cmlA1 major facilitator superfamily (MFS) antibiotic efflux pump; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 36524 " 1038 UPDATE cmlB1 major facilitator superfamily (MFS) antibiotic efflux pump; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 36524 " 1039 UPDATE dfrB3 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 1040 UPDATE OXA-95 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1044 UPDATE CTX-M-22 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1046 UPDATE vgaD vga-type ABC-F protein; streptogramin antibiotic; pleuromutilin antibiotic; antibiotic target protection; ARO_category "DELETED 37018 " 1047 UPDATE catS chloramphenicol acetyltransferase (CAT); phenicol antibiotic; antibiotic inactivation; ARO_category "DELETED 36521 " 1048 UPDATE QnrB33 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 1052 UPDATE OXA-206 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1057 UPDATE CTX-M-114 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1059 UPDATE APH(9)-Ib APH(9); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35957 " 1063 UPDATE QnrB73 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 1064 UPDATE CTX-M-141 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1065 UPDATE OXA-384 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1066 UPDATE TEM-118 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1068 UPDATE AAC(6')-Ib3 AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35932 " 1070 UPDATE sul1 sulfonamide resistant sul; sulfonamide antibiotic; antibiotic target replacement; ARO_category "DELETED 36463 " 1072 UPDATE OXA-37 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 1075 UPDATE TEM-20 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1077 UPDATE OXA-420 OXA-58-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1079 UPDATE OXA-161 OXA-2-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1082 UPDATE CTX-M-7 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1083 UPDATE OXA-323 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1087 UPDATE OXA-253 OXA-143-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1090 UPDATE TEM-169 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1093 UPDATE AAC(6')-31 AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35924 " 1096 UPDATE TEM-79 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1097 UPDATE Erm(38) Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35925 " 1098 UPDATE vanB glycopeptide resistance gene cluster; Van ligase; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 1099 UPDATE OXA-48 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1100 UPDATE OXA-245 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1101 UPDATE CTX-M-21 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1102 UPDATE QnrB29 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 1104 UPDATE acrB resistance-nodulation-cell division (RND) antibiotic efflux pump; fluoroquinolone antibiotic; cephalosporin; glycylcycline; penicillin beta-lactam; tetracycline antibiotic; rifamycin antibiotic; phenicol antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 35949 " 1105 UPDATE AAC(3)-VIa AAC(3); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35953 " 1106 UPDATE NDM-5 NDM beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35927 " 1111 UPDATE AAC(6')-Ig AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 1112 UPDATE OXA-58 OXA-58-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1113 UPDATE ANT(6)-Ib ANT(6); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35958 " 1115 UPDATE OXA-435 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1116 UPDATE arr-2 rifampin ADP-ribosyltransferase (Arr); rifamycin antibiotic; antibiotic inactivation; ARO_category "DELETED 36308 " 1117 UPDATE ErmD Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35925 " 1118 UPDATE OXA-2 OXA-2-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1120 UPDATE IMI-7 IMI beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 0000032 UPDATED category_aro_cvterm_id with 35951 UPDATED category_aro_name with cephalosporin UPDATED category_aro_description with Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000008 UPDATED category_aro_cvterm_id with 36017 UPDATED category_aro_name with penicillin beta-lactam UPDATED category_aro_description with Penicilins (Penams) are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. Penicillin-like antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_class_name with Drug Class " 1121 UPDATE APH(3')-VIa APH(3'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35924 " 1122 UPDATE OXA-180 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1124 UPDATE TEM-186 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1126 UPDATE OXA-184 OXA-184-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1127 UPDATE CTX-M-64 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1128 UPDATE OXA-23 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1130 UPDATE PDC-9 PDC beta-lactamase; monobactam; carbapenem; cephalosporin; antibiotic inactivation; ARO_category "DELETED 35977 " 1131 UPDATE AAC(3)-Ic AAC(3); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35922 " 1027 UPDATE tet(H) major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 1092 UPDATE tet(39) major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 1067 UPDATE MexE resistance-nodulation-cell division (RND) antibiotic efflux pump; fluoroquinolone antibiotic; diaminopyrimidine antibiotic; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 35954 " 1041 UPDATE MexS resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; fluoroquinolone antibiotic; diaminopyrimidine antibiotic; phenicol antibiotic; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35954 " 988 UPDATE tet(J) major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 1006 UPDATE tet(V) major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 1050 UPDATE AAC(6')-Ii AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 1132 UPDATE OXA-88 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1137 UPDATE TEM-90 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1139 UPDATE dfrA12 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 1141 UPDATE OXA-169 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1142 UPDATE dfrA17 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 1143 UPDATE OXA-7 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1004 UPDATE vanR gene in vanD cluster glycopeptide resistance gene cluster; vanR; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 1030 UPDATE vanZ gene in vanA cluster vanZ; glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 1045 UPDATE ErmO-srmA Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35964 " 1145 UPDATE CTX-M-124 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1146 UPDATE TEM-156 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1148 UPDATE OXA-363 OXA-134-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1150 UPDATE QnrVC5 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 1151 UPDATE OXA-240 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1152 UPDATE CTX-M-39 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1154 UPDATE TEM-146 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1156 UPDATE Erm(31) Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 37625 " 1157 UPDATE vanG glycopeptide resistance gene cluster; Van ligase; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 1159 UPDATE TEM-129 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1160 UPDATE QnrB34 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 1161 UPDATE lsaB lsa-type ABC-F protein; lincosamide antibiotic; streptogramin antibiotic; pleuromutilin antibiotic; antibiotic target protection; ARO_category "DELETED 35983 " 1162 UPDATE aadA15 ANT(3''); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35957 " 1167 UPDATE norB major facilitator superfamily (MFS) antibiotic efflux pump; fluoroquinolone antibiotic; antibiotic efflux; ARO_category "DELETED 35954 " 1168 UPDATE NDM-9 NDM beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 45729 " 1169 UPDATE OXA-360 OXA-134-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1172 UPDATE OXA-194 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1173 UPDATE TEM-54 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1174 UPDATE QnrB22 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 1180 UPDATE mdsC resistance-nodulation-cell division (RND) antibiotic efflux pump; monobactam; carbapenem; cephalosporin; penicillin beta-lactam; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 36524 " 1181 UPDATE cmeA resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; fluoroquinolone antibiotic; cephalosporin; fusidane antibiotic; antibiotic efflux; ARO_category "DELETED 35925 " 1182 UPDATE CTX-M-105 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1184 UPDATE OXA-182 OXA-143-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1185 UPDATE OXA-176 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1186 UPDATE OXA-327 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1187 UPDATE OXA-248 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1188 UPDATE ErmV Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35925 " 1189 UPDATE vatB streptogramin vat acetyltransferase; streptogramin antibiotic; antibiotic inactivation; ARO_category "DELETED 37013 " 1190 UPDATE OXA-354 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1191 UPDATE mdtM major facilitator superfamily (MFS) antibiotic efflux pump; fluoroquinolone antibiotic; lincosamide antibiotic; nucleoside antibiotic; phenicol antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 35963 " 1193 UPDATE ErmH Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35925 " 1194 UPDATE OXA-16 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 1196 UPDATE OXA-71 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1200 UPDATE msrA msr-type ABC-F protein; macrolide antibiotic; streptogramin antibiotic; antibiotic target protection; ARO_category "DELETED 35925 " 1202 UPDATE CTX-M-28 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1209 UPDATE QnrB45 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 1210 UPDATE novA ATP-binding cassette (ABC) antibiotic efflux pump; aminocoumarin antibiotic; antibiotic efflux; ARO_category "DELETED 36250 " 1212 UPDATE OXA-141 OXA-2-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3304 UPDATE erm(40) Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35925 " 1214 UPDATE TEM-134 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1215 UPDATE FosC fosC phosphotransferase family; phosphonic acid antibiotic; antibiotic inactivation; ARO_category "DELETED 35944 " 1217 UPDATE OXA-139 OXA-24-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1218 UPDATE TEM-219 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1221 UPDATE OXA-231 OXA-143-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1224 UPDATE Erm(30) Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 37625 " 1225 UPDATE TEM-178 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1226 UPDATE adeG resistance-nodulation-cell division (RND) antibiotic efflux pump; fluoroquinolone antibiotic; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 1227 UPDATE aadA2 ANT(3''); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35957 " 1229 UPDATE CTX-M-6 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1230 UPDATE CTX-M-33 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1231 UPDATE mel msr-type ABC-F protein; macrolide antibiotic; streptogramin antibiotic; antibiotic target protection; ARO_category "DELETED 35925 " 1232 UPDATE cmeR resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; macrolide antibiotic; fluoroquinolone antibiotic; cephalosporin; fusidane antibiotic; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35925 " 1235 UPDATE AAC(6')-Ib' AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35932 " 1238 UPDATE OXA-397 OXA-58-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1241 UPDATE TEM-144 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1242 UPDATE aadA6/aadA10 ANT(3''); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35957 " 1243 UPDATE mphA macrolide phosphotransferase (MPH); macrolide antibiotic; antibiotic inactivation; ARO_category "DELETED 35925 " 1245 UPDATE TEM-114 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1246 UPDATE AAC(2')-Ic AAC(2'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 1248 UPDATE H-NS major facilitator superfamily (MFS) antibiotic efflux pump; resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; macrolide antibiotic; fluoroquinolone antibiotic; cephalosporin; penicillin beta-lactam; tetracycline antibiotic; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35925 " 1250 UPDATE CTX-M-96 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1251 UPDATE CTX-M-157 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1252 UPDATE ceoB resistance-nodulation-cell division (RND) antibiotic efflux pump; fluoroquinolone antibiotic; aminoglycoside antibiotic; antibiotic efflux; ARO_category "DELETED 36298 " 1254 UPDATE CTX-M-46 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1255 UPDATE OXA-119 OXA-46-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1256 UPDATE bmr major facilitator superfamily (MFS) antibiotic efflux pump; fluoroquinolone antibiotic; nucleoside antibiotic; phenicol antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 35963 " 1257 UPDATE QnrB68 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 1258 UPDATE OXA-55 OXA-55-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1260 UPDATE APH(3')-IVa APH(3'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35924 " 1261 UPDATE rosA major facilitator superfamily (MFS) antibiotic efflux pump; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic efflux; model_param; model_sequences; ARO_category "UPDATED param_value with 700 UPDATED accession with HHH2222284.1 UPDATED sequence with MTDRSETELPPSVNTQPFDNTKVKRTSFSILGAISVSHLLNDMIQSLILAIYPLLQAEFSLSFAQIGLITLTYQLTASLLQPLIGLYTDKHPQPYSLPIGMGFTLSGILLLAVATTFPVVLLAAALVGTGSSVFHPESSRVARMASGGRHGMAQSIFQVGGNFGNALGPLLAAILIAPYGKGNVGWFSLAALLAIVVLLQVSKWYQQQQRATYGKVVKVSSAKILPKKTVISALVILMVLIFSKYFYLTSISSYYTFYLMHRFGVSVQNAQIHLFVFLFAVAAGTIIGGPLGDRIGRKYVIWGSILGVAPFTLILPYVSLYWTGVLTVIIGLILASAFSAILVYAQELIPGKVGMVSGLFFGFAFGMGGLGAAVLGYVADLTSIELVYQICAFLPLLGIITVFLPNIEDK UPDATED accession with DBHZIT010000030.1 UPDATED fmin with 8250 UPDATED fmax with 9483 UPDATED strand with - UPDATED sequence with ATGACCGATCGTTCTGAGACGGAACTCCCTCCCTCCGTCAATACCCAACCCTTCGATAATACCAAGGTAAAGCGCACATCATTTTCCATCTTGGGTGCGATCAGCGTATCTCACTTACTTAACGATATGATCCAGTCGCTAATTCTGGCGATTTATCCTTTATTACAAGCTGAATTTTCTCTGAGTTTTGCGCAGATAGGATTAATCACCCTCACTTACCAACTGACCGCCTCATTATTACAGCCACTTATTGGTCTCTATACCGATAAGCATCCGCAGCCCTATTCACTGCCAATTGGCATGGGTTTCACCTTATCAGGTATCTTGCTGCTTGCAGTTGCCACGACTTTCCCGGTGGTTTTACTGGCAGCGGCATTAGTCGGAACCGGTTCTTCGGTCTTCCACCCAGAATCCTCCCGCGTAGCCCGTATGGCATCCGGTGGCCGCCACGGTATGGCTCAGTCTATTTTTCAAGTGGGAGGCAACTTCGGCAACGCTCTCGGCCCACTATTAGCCGCTATCCTTATTGCACCTTACGGTAAAGGCAATGTAGGTTGGTTTTCACTCGCGGCACTGCTGGCTATTGTGGTGCTGTTGCAGGTCAGTAAATGGTATCAGCAACAACAAAGAGCAACCTATGGCAAAGTAGTAAAAGTCTCATCGGCCAAAATACTGCCTAAAAAGACGGTTATTAGCGCGTTAGTTATCTTGATGGTACTGATATTCTCTAAATACTTCTACTTGACCAGTATCAGCAGCTATTACACCTTTTATCTGATGCATAGGTTCGGTGTTTCGGTACAAAATGCCCAAATACATTTGTTTGTGTTCTTATTTGCCGTTGCCGCAGGCACCATCATTGGCGGGCCTCTTGGCGATAGGATAGGTCGAAAGTATGTTATTTGGGGGTCAATATTGGGCGTTGCGCCATTTACCCTTATTTTACCCTACGTTTCTCTGTATTGGACCGGGGTTTTAACCGTGATCATTGGCCTTATCCTCGCCTCTGCCTTCTCGGCAATACTGGTGTATGCGCAAGAGCTTATTCCGGGGAAAGTGGGCATGGTATCTGGTCTATTCTTCGGTTTTGCTTTCGGTATGGGGGGTTTAGGTGCGGCTGTACTAGGGTATGTTGCTGATTTAACCAGTATTGAGCTAGTTTATCAAATATGCGCCTTCTTACCATTACTGGGGATAATTACGGTCTTCCTGCCTAATATAGAAGATAAGTAA UPDATED partial with 0 UPDATED NCBI_taxonomy_cvterm_id with 40164 UPDATED NCBI_taxonomy_name with Yersinia enterocolitica UPDATED NCBI_taxonomy_id with 630 DELETED 4717 UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36593 " 1263 UPDATE QnrB56 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 1264 UPDATE smeC resistance-nodulation-cell division (RND) antibiotic efflux pump; aminoglycoside antibiotic; cephalosporin; penicillin beta-lactam; antibiotic efflux; ARO_category "DELETED 36298 " 1266 UPDATE ANT(4')-IIa ANT(4'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35932 " 1267 UPDATE QnrB40 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 1269 UPDATE OXA-192 OXA-63-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1270 UPDATE QnrS3 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 1271 UPDATE AAC(6')-Iw AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 1272 UPDATE CTX-M-67 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1275 UPDATE ErmT Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35925 " 1276 UPDATE OXA-210 OXA-2-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1278 UPDATE TEM-45 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1279 UPDATE TEM-104 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1280 UPDATE QnrB12 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 1281 UPDATE OXA-110 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1287 UPDATE CTX-M-110 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1288 UPDATE OXA-82 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1290 UPDATE TEM-141 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1291 UPDATE TEM-177 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1292 UPDATE CTX-M-109 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1293 UPDATE OXA-197 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1138 UPDATE tet(D) major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 1295 UPDATE catII chloramphenicol acetyltransferase (CAT); phenicol antibiotic; antibiotic inactivation; ARO_category "DELETED 36521 " 1297 UPDATE CTX-M-80 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1298 UPDATE lsaA lsa-type ABC-F protein; lincosamide antibiotic; streptogramin antibiotic; pleuromutilin antibiotic; antibiotic target protection; ARO_category "DELETED 35983 " 1299 UPDATE AAC(6')-Ic AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 3305 UPDATE EreD macrolide esterase; macrolide antibiotic; antibiotic inactivation; ARO_category "DELETED 35925 " 1304 UPDATE CTX-M-85 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1171 UPDATE tet(44) tetracycline-resistant ribosomal protection protein; tetracycline antibiotic; antibiotic target protection; ARO_category "DELETED 35968 " 1198 UPDATE mef(B) major facilitator superfamily (MFS) antibiotic efflux pump; macrolide antibiotic; antibiotic efflux; ARO_category "DELETED 35925 " 1206 UPDATE QepA1 major facilitator superfamily (MFS) antibiotic efflux pump; fluoroquinolone antibiotic; antibiotic efflux; ARO_category "DELETED 35954 " 1223 UPDATE vph viomycin phosphotransferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35937 " 1285 UPDATE SAT-2 streptothricin acetyltransferase (SAT); nucleoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35931 " 1222 UPDATE FosA fosfomycin thiol transferase; phosphonic acid antibiotic; antibiotic inactivation; ARO_category "DELETED 35944 " 1312 UPDATE OXA-111 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1313 UPDATE adeA resistance-nodulation-cell division (RND) antibiotic efflux pump; glycylcycline; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35949 " 1314 UPDATE OXA-214 OXA-214-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1315 UPDATE mdtC resistance-nodulation-cell division (RND) antibiotic efflux pump; aminocoumarin antibiotic; antibiotic efflux; ARO_category "DELETED 36250 " 1317 UPDATE CTX-M-3 CTX-M beta-lactamase; cephalosporin; penicillin beta-lactam; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class DELETED 35927 " 1318 UPDATE evgS major facilitator superfamily (MFS) antibiotic efflux pump; resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; macrolide antibiotic; fluoroquinolone antibiotic; penicillin beta-lactam; tetracycline antibiotic; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35925 " 1321 UPDATE mecA PBP2-like beta-lactam resistant peptidoglycan transpeptidase; cephalosporin; penicillin beta-lactam; antibiotic target replacement; model_sequences; ARO_description; ARO_category "UPDATED accession with WP_057521704.1 UPDATED sequence with MKKIKIVPLILIVVVVGFGIYFYASKDKEINNTIDAIEDKNFKQVYKDSSYISKSDNGEVEMTERPIKIYNSLGVKDINIQDRKIKKVSKNKKRVDAQYKIKTNYGNIDRNVQFNFVKEDGMWKLDWDHSVIIPGMQKDQSIHIENLKSERGKILDRNNVELANTGTAYEIGIVPKNVSKKDYKAIAKELSISEDYIKQQMDQNWVQDDTFVPLKTVKKMDEYLSDFAKKFHLTTNETKSRNYPLEKATSHLLGYVGPINSEELKQKEYKGYKDDAVIGKKGLEKLYDKKLQHEDGYRVTIVDDNSNTIAHTLIEKKKKDGKDIQLTIDAKVQKSIYNNMKNDYGSGTAIHPQTGELLALVSTPSYDVYPFMYGMSNEEYNKLTEDKKEPLLNKFQITTSPGSTQKILTAMIGLNNKTLDDKTSYKIDGKGWQKDKSWGGYNVTRYEVVNGNIDLKQAIESSDNIFFARVALELGSKKFEKGMKKLGVGEDIPSDYPFYNAQISNKNLDNEILLADSGYGQGEILINPVQILSIYSALENNGNINAPHLLKDTKNKVWKKNIISKENINLLTDGMQQVVNKTHKEDIYRSYANLIGKSGTAELKMKQGETGRQIGWFISYDKDNPNMMMAINVKDVQDKGMASYNAKISGKVYDELYENGNKKYDIDE UPDATED accession with NG_047945.1 UPDATED fmin with 0 UPDATED fmax with 2007 UPDATED strand with + UPDATED sequence with ATGAAAAAGATAAAAATTGTTCCACTTATTTTAATAGTTGTAGTTGTCGGGTTTGGTATATATTTTTATGCTTCAAAAGATAAAGAAATTAATAATACTATTGATGCAATTGAAGATAAAAATTTCAAACAAGTTTATAAAGATAGCAGTTATATTTCTAAAAGCGATAATGGTGAAGTAGAAATGACTGAACGTCCGATAAAAATATATAATAGTTTAGGCGTTAAAGATATAAACATTCAGGATCGTAAAATAAAAAAAGTATCTAAAAATAAAAAACGAGTAGATGCTCAATATAAAATTAAAACAAACTACGGTAACATTGATCGCAACGTTCAATTTAATTTTGTTAAAGAAGATGGTATGTGGAAGTTAGATTGGGATCATAGCGTCATTATTCCAGGAATGCAGAAAGACCAAAGCATACATATTGAAAATTTAAAATCAGAACGTGGTAAAATTTTAGACCGAAACAATGTGGAATTGGCCAATACAGGAACAGCATATGAGATAGGCATCGTTCCAAAGAATGTATCTAAAAAAGATTATAAAGCAATCGCTAAAGAACTAAGTATTTCTGAAGACTATATCAAACAACAAATGGATCAAAATTGGGTACAAGATGATACCTTCGTTCCACTTAAAACCGTTAAAAAAATGGATGAATATTTAAGTGATTTCGCAAAAAAATTTCATCTTACAACTAATGAAACAAAAAGTCGTAACTATCCTCTAGAAAAAGCGACTTCACATCTATTAGGTTATGTTGGTCCCATTAACTCTGAAGAATTAAAACAAAAAGAATATAAAGGCTATAAAGATGATGCAGTTATTGGTAAAAAGGGACTCGAAAAACTTTACGATAAAAAGCTCCAACATGAAGATGGCTATCGTGTCACAATCGTTGACGATAATAGCAATACAATCGCACATACATTAATAGAGAAAAAGAAAAAAGATGGCAAAGATATTCAACTAACTATTGATGCTAAAGTTCAAAAGAGTATTTATAACAACATGAAAAATGATTATGGCTCAGGTACTGCTATCCACCCTCAAACAGGTGAATTATTAGCACTTGTAAGCACACCTTCATATGACGTCTATCCATTTATGTATGGCATGAGTAACGAAGAATATAATAAATTAACCGAAGATAAAAAAGAACCTCTGCTCAACAAGTTCCAGATTACAACTTCACCAGGTTCAACTCAAAAAATATTAACAGCAATGATTGGGTTAAATAACAAAACATTAGACGATAAAACAAGTTATAAAATCGATGGTAAAGGTTGGCAAAAAGATAAATCTTGGGGTGGTTACAACGTTACAAGATATGAAGTGGTAAATGGTAATATCGACTTAAAACAAGCAATAGAATCATCAGATAACATTTTCTTTGCTAGAGTAGCACTCGAATTAGGCAGTAAGAAATTTGAAAAAGGCATGAAAAAACTAGGTGTTGGTGAAGATATACCAAGTGATTATCCATTTTATAATGCTCAAATTTCAAACAAAAATTTAGATAATGAAATATTATTAGCTGATTCAGGTTACGGACAAGGTGAAATACTGATTAACCCAGTACAGATCCTTTCAATCTATAGCGCATTAGAAAATAATGGCAATATTAACGCACCTCACTTATTAAAAGACACGAAAAACAAAGTTTGGAAGAAAAATATTATTTCCAAAGAAAATATCAATCTATTAACTGATGGTATGCAACAAGTCGTAAATAAAACACATAAAGAAGATATTTATAGATCTTATGCAAACTTAATTGGCAAATCCGGTACTGCAGAACTCAAAATGAAACAAGGAGAAACTGGCAGACAAATTGGGTGGTTTATATCATATGATAAAGATAATCCAAACATGATGATGGCTATTAATGTTAAAGATGTACAAGATAAAGGAATGGCTAGCTACAATGCCAAAATCTCAGGTAAAGTGTATGATGAGCTATATGAGAACGGTAATAAAAAATACGATATAGATGAATAA UPDATED partial with 0 UPDATED NCBI_taxonomy_cvterm_id with 35508 UPDATED NCBI_taxonomy_name with Staphylococcus aureus UPDATED NCBI_taxonomy_id with 1280 DELETED 227 UPDATED ARO_description with mecA encodes an alternative PBP2a protein involved in bacterial cell wall formation. These proteins are acquired by lateral gene transfer and commonly associated with methicillin-resistant Staphylococcus aureus (MRSA). These proteins have lower affinity for penicillin-like antibiotics and therefore are able to perform peptidoglycan synthesis in the presence of beta-lactams. UPDATED category_aro_accession with 3009312 UPDATED category_aro_cvterm_id with 48160 UPDATED category_aro_name with PBP2-like beta-lactam resistant peptidoglycan transpeptidase UPDATED category_aro_description with Peptidoglycan transpeptidase proteins involved in bacterial cell wall formation and which have decreased susceptibility to some beta-lactam antibiotics. These alternative transpeptidases are found in certain organisms, like Staphylococcus aureus, and have lower affinity for penicillin-like antibiotics, such as methicillin. In these organisms, these proteins do not bind to the beta-lactam ring and therefore transpeptidase activity continues in the presence of beta-lactams, thereby conferring resistance to these drugs. These proteins are commonly clinically associated with methicillin-resistant Staphylococcus aureus (MRSA). UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_accession with 0000032 UPDATED category_aro_cvterm_id with 35951 UPDATED category_aro_name with cephalosporin UPDATED category_aro_description with Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class DELETED 37589 " 1183 UPDATE tet(Q) tetracycline-resistant ribosomal protection protein; tetracycline antibiotic; antibiotic target protection; ARO_category "DELETED 35968 " 1233 UPDATE tet(32) tetracycline-resistant ribosomal protection protein; tetracycline antibiotic; antibiotic target protection; ARO_category "DELETED 35968 " 1325 UPDATE OXA-65 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1326 UPDATE OXA-170 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1327 UPDATE AAC(6')-Iq AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 1329 UPDATE ANT(4')-IIb ANT(4'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35932 " 1330 UPDATE emrR major facilitator superfamily (MFS) antibiotic efflux pump; antibiotic efflux regulatory protein; fluoroquinolone antibiotic; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 37005 " 1331 UPDATE CTX-M-52 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1332 UPDATE APH(3')-IIIa APH(3'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35924 " 1335 UPDATE QnrB8 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 1340 UPDATE mtrC resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; antibiotic efflux; ARO_category "DELETED 35925 " 1341 UPDATE OXA-53 OXA-2-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1343 UPDATE OXA-166 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1347 UPDATE OXA-425 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1350 UPDATE TEM-93 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1351 UPDATE QnrVC1 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 1352 UPDATE OXA-251 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1355 UPDATE TEM-149 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1356 UPDATE dfrA22 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 1357 UPDATE CTX-M-132 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1359 UPDATE OXA-233 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1361 UPDATE OXA-223 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1365 UPDATE AAC(6')-I30 AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 1366 UPDATE cmx major facilitator superfamily (MFS) antibiotic efflux pump; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 36524 " 1367 UPDATE oleD ole glycosyltransferase; macrolide antibiotic; antibiotic inactivation; ARO_category "DELETED 35925 " 1368 UPDATE abeM multidrug and toxic compound extrusion (MATE) transporter; fluoroquinolone antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 35954 " 1369 UPDATE QnrB69 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 1370 UPDATE AAC(6')-Ib10 AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35932 " 1371 UPDATE CTX-M-26 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1372 UPDATE ANT(2'')-Ia ANT(2''); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 1377 UPDATE CTX-M-60 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1378 UPDATE AAC(3)-IIc AAC(3); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 1379 UPDATE OXA-313 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1380 UPDATE TEM-193 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1382 UPDATE rmtG 16S rRNA methyltransferase (G1405); aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35932 " 1383 UPDATE IMI-4 IMI beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 0000032 UPDATED category_aro_cvterm_id with 35951 UPDATED category_aro_name with cephalosporin UPDATED category_aro_description with Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000008 UPDATED category_aro_cvterm_id with 36017 UPDATED category_aro_name with penicillin beta-lactam UPDATED category_aro_description with Penicilins (Penams) are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. Penicillin-like antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_class_name with Drug Class " 1384 UPDATE OXA-382 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1385 UPDATE mdsB resistance-nodulation-cell division (RND) antibiotic efflux pump; monobactam; carbapenem; cephalosporin; penicillin beta-lactam; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 36524 " 1386 UPDATE ANT(9)-Ia ANT(9); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35957 " 1387 UPDATE OXA-99 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1388 UPDATE oleB Miscellaneous ABC-F subfamily ATP-binding cassette ribosomal protection proteins; macrolide antibiotic; antibiotic target protection; ARO_category "DELETED 37247 " 1390 UPDATE arlR major facilitator superfamily (MFS) antibiotic efflux pump; antibiotic efflux regulatory protein; fluoroquinolone antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35954 " 1391 UPDATE CTX-M-92 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1392 UPDATE aadA22 ANT(3''); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35957 " 1394 UPDATE OXA-257 OXA-229-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1396 UPDATE OXA-11 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1397 UPDATE dfrC trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 1398 UPDATE OXA-108 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1399 UPDATE OXA-315 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1400 UPDATE CTX-M-74 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1402 UPDATE OXA-390 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1403 UPDATE OXA-388 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1405 UPDATE armA 16S rRNA methyltransferase (G1405); aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35926 " 1406 UPDATE OXA-121 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1408 UPDATE TEM-124 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1410 UPDATE OXA-19 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1411 UPDATE OXA-62 OXA-62-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1413 UPDATE OXA-172 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1414 UPDATE QnrB15 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 1415 UPDATE AAC(2')-Id AAC(2'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 1416 UPDATE OXA-89 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1417 UPDATE OXA-131 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1419 UPDATE OXA-454 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1420 UPDATE aadA5 ANT(3''); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35957 " 1421 UPDATE TEM-85 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1422 UPDATE ACC-3 ACC beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1423 UPDATE TEM-15 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1425 UPDATE RbpA RbpA bacterial RNA polymerase-binding protein; rifamycin antibiotic; antibiotic target protection; ARO_category "DELETED 36308 " 1427 UPDATE acrD resistance-nodulation-cell division (RND) antibiotic efflux pump; aminoglycoside antibiotic; antibiotic efflux; ARO_category "DELETED 35924 " 1434 UPDATE Erm(35) Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35925 " 1435 UPDATE cmlA6 major facilitator superfamily (MFS) antibiotic efflux pump; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 36524 " 1436 UPDATE TEM-40 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1440 UPDATE CTX-M-103 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1442 UPDATE mdtN major facilitator superfamily (MFS) antibiotic efflux pump; nucleoside antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 35963 " 1449 UPDATE OXA-59 OXA-42-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1452 UPDATE TEM-216 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1457 UPDATE CTX-M-13 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1458 UPDATE TEM-157 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1459 UPDATE CTX-M-78 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1460 UPDATE FosB3 fosfomycin thiol transferase; phosphonic acid antibiotic; antibiotic inactivation; ARO_category "DELETED 35944 " 1345 UPDATE tet(K) major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 1464 UPDATE aadA7 ANT(3''); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35957 " 1469 UPDATE facT major facilitator superfamily (MFS) antibiotic efflux pump; elfamycin antibiotic; antibiotic efflux; ARO_category "DELETED 37619 " 1470 UPDATE QnrB26 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 1471 UPDATE adeI resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; fluoroquinolone antibiotic; lincosamide antibiotic; carbapenem; cephalosporin; penicillin beta-lactam; tetracycline antibiotic; rifamycin antibiotic; diaminopyrimidine antibiotic; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 1333 UPDATE vanH gene in vanD cluster vanH; glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 1344 UPDATE MexH resistance-nodulation-cell division (RND) antibiotic efflux pump; fluoroquinolone antibiotic; tetracycline antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3000050 UPDATED category_aro_cvterm_id with 36189 UPDATED category_aro_name with tetracycline antibiotic UPDATED category_aro_description with These antibiotics are derived from tetracycline, a polyketide antibiotic that inhibits the 30S subunit of bacterial ribosomes. UPDATED category_aro_class_name with Drug Class DELETED 35963 " 1437 UPDATE AcrF resistance-nodulation-cell division (RND) antibiotic efflux pump; fluoroquinolone antibiotic; cephalosporin; penicillin beta-lactam; antibiotic efflux; ARO_category "DELETED 35954 " 1445 UPDATE AcrE resistance-nodulation-cell division (RND) antibiotic efflux pump; fluoroquinolone antibiotic; cephalosporin; penicillin beta-lactam; antibiotic efflux; ARO_category "DELETED 35954 " 1342 UPDATE Plasmid-encoded cat (pp-cat) chloramphenicol acetyltransferase (CAT); phenicol antibiotic; antibiotic inactivation; ARO_category "DELETED 36521 " 1316 UPDATE Pseudomonas aeruginosa catB6 chloramphenicol acetyltransferase (CAT); phenicol antibiotic; antibiotic inactivation; ARO_category "DELETED 36521 " 1473 UPDATE CTX-M-44 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1476 UPDATE TEM-199 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1483 UPDATE AAC(3)-Xa AAC(3); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35966 " 1488 UPDATE TEM-75 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1491 UPDATE lnuF lincosamide nucleotidyltransferase (LNU); lincosamide antibiotic; antibiotic inactivation; ARO_category "DELETED 35964 " 1496 UPDATE OXA-224 OXA-1-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1497 UPDATE dfrA10 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 1500 UPDATE APH(6)-Ia APH(6); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35958 " 1337 UPDATE baeR resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; aminoglycoside antibiotic; aminocoumarin antibiotic; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35924 " 1502 UPDATE OXA-209 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 1507 UPDATE smeA resistance-nodulation-cell division (RND) antibiotic efflux pump; aminoglycoside antibiotic; cephalosporin; penicillin beta-lactam; antibiotic efflux; ARO_category "DELETED 36298 " 1508 UPDATE QnrA2 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 1511 UPDATE OXA-423 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1513 UPDATE QnrB64 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 1517 UPDATE OXA-33 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 1518 UPDATE EreA2 macrolide esterase; macrolide antibiotic; antibiotic inactivation; ARO_category "DELETED 35925 " 1519 UPDATE vatE streptogramin vat acetyltransferase; streptogramin antibiotic; antibiotic inactivation; ARO_category "DELETED 37013 " 1525 UPDATE TEM-160 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1526 UPDATE AAC(6')-Iaa AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 1528 UPDATE TEM-168 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1529 UPDATE TEM-130 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1530 UPDATE OXA-67 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1531 UPDATE TEM-81 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1532 UPDATE OXA-249 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1536 UPDATE OXA-421 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1539 UPDATE aadA3 ANT(3''); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35957 " 1540 UPDATE rmtC 16S rRNA methyltransferase (G1405); aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35926 " 1542 UPDATE amrA resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; aminoglycoside antibiotic; antibiotic efflux; ARO_category "DELETED 35969 " 1544 UPDATE dfrE trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 1546 UPDATE Erm(43) Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35925 " 1548 UPDATE APH(3')-Vb APH(3'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35924 " 1549 UPDATE ErmB Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35925 " 1550 UPDATE smeR resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; aminoglycoside antibiotic; cephalosporin; penicillin beta-lactam; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 36298 " 1551 UPDATE OXA-78 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1554 UPDATE norA major facilitator superfamily (MFS) antibiotic efflux pump; fluoroquinolone antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 35954 " 1559 UPDATE mtrA resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; macrolide antibiotic; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35925 " 1562 UPDATE aad(6) ANT(6); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35958 " 1563 UPDATE CTX-M-63 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1564 UPDATE QnrB16 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 1567 UPDATE FosB fosfomycin thiol transferase; phosphonic acid antibiotic; antibiotic inactivation; ARO_category "DELETED 35944 " 1568 UPDATE OXA-183 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1572 UPDATE OXA-205 OXA-46-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1575 UPDATE OXA-91 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1576 UPDATE OXA-17 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1577 UPDATE AAC(6')-32 AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35932 " 1579 UPDATE QnrB9 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 1580 UPDATE catIII chloramphenicol acetyltransferase (CAT); phenicol antibiotic; antibiotic inactivation; ARO_category "DELETED 36521 " 1582 UPDATE dfrA5 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 1583 UPDATE QnrVC6 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 1586 UPDATE CTX-M-32 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1587 UPDATE OXA-10 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1588 UPDATE QnrB50 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 1590 UPDATE QnrB27 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 1592 UPDATE dfrA14 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 1595 UPDATE mecB PBP2-like beta-lactam resistant peptidoglycan transpeptidase; penicillin beta-lactam; antibiotic target replacement; model_sequences; ARO_description; ARO_category "UPDATED accession with WP_012655867.1 UPDATED sequence with MKNKALAILIICICLLIAYNFVKKDEVDKIFDAIELRDSEYLNEHATFLSKSLYDKDQRYKRMDKIDASLGIKEVKVSNVRLVQKKKNKRQYSANLNFRTKYGNFSREGNYSFEKDEITKKWLLDWSPEVIIPGLTDRNQISIETLESFRGKILDRNGIDIAKDGIHYEVGIDIKNLNKKNKKNISKLLSISESTLNKKLKQTWVKEGVFLPLKSYIELDDELKLGIQKYHLTVNQTKGRVYPLREATVHLLGYVGEINAEELKNKKFKDYDEHSIVGKSGIELQYDKQLQNKDGYKVVITSDDALNNDEDVLLEKKPKNGQDIILTIDSKVQRSIYSHLKEDNGSGVAMNPKTGELLALVSYPAYDPYEFMFGISDENYKKIVNDKKEPLLNKFQTTSSPGSTQKLITSIIGLKNGTIDASTSYNIVTKGWQRNSSWGGYEVTRFEEVNGDIDLEKAIAHSDNIFFARATLDMGSEKFIKGMKALDIGRNIPSDYYFQKGQIANPESLKNNFKNEILLADSGYGQGEILISPVQILSIYSSLINEGKMMKPKLFETTKEDIWKNHIISKDDVDILTRSMRKVVTGTHRLDAERNYAQFAGKTGTAELKTSREEGLGAQIGWFVGYDQNNPNMMLGISVKNVENKGMSSYNARKFAEIMDELYENGTKKYEIDR UPDATED accession with NG_047953.1 UPDATED fmin with 100 UPDATED fmax with 2125 UPDATED strand with + UPDATED sequence with ATGAAAAATAAAGCTTTAGCAATTTTAATTATATGTATTTGCCTTTTAATAGCATATAATTTTGTGAAAAAAGATGAAGTTGATAAAATATTTGATGCTATTGAATTAAGGGATTCGGAATATCTGAATGAACATGCGACATTCTTATCTAAAAGTCTTTACGACAAAGATCAGAGATATAAAAGAATGGATAAGATTGATGCTTCTCTTGGTATTAAAGAAGTGAAAGTTAGTAATGTACGACTCGTGCAAAAGAAAAAAAATAAACGTCAATATAGTGCAAATTTAAATTTTAGAACTAAATATGGTAATTTTTCTAGAGAAGGGAACTATTCTTTTGAAAAGGATGAAATAACAAAAAAATGGCTTTTGGATTGGTCACCTGAGGTTATAATACCGGGATTGACTGATAGAAATCAAATCAGTATAGAAACCTTGGAATCTTTCAGAGGGAAAATACTAGACAGAAACGGGATTGATATAGCGAAAGACGGAATTCATTACGAAGTTGGAATAGATATTAAAAATTTAAATAAAAAAAATAAGAAAAATATTTCAAAATTGTTATCAATAAGTGAATCGACACTAAATAAAAAGTTAAAACAAACATGGGTAAAAGAAGGTGTTTTTTTACCTTTAAAATCGTACATAGAGTTGGATGATGAACTTAAATTGGGTATCCAAAAATATCATTTGACGGTTAATCAAACAAAAGGTAGGGTTTATCCATTAAGAGAAGCAACAGTACATCTTTTAGGGTATGTTGGAGAAATTAATGCTGAAGAATTAAAGAATAAAAAGTTTAAGGATTATGATGAACACTCAATCGTAGGAAAAAGTGGTATCGAACTACAATATGATAAACAATTGCAAAATAAAGATGGTTATAAAGTTGTCATAACTAGTGATGATGCATTAAATAATGATGAAGATGTCTTGTTAGAAAAGAAACCAAAAAATGGACAGGACATTATATTAACAATTGATAGCAAAGTACAAAGAAGTATATATAGTCATTTAAAAGAAGATAATGGTTCAGGAGTAGCCATGAATCCTAAAACTGGTGAATTATTAGCTTTAGTTAGTTATCCTGCATATGACCCCTATGAGTTTATGTTCGGCATTTCCGACGAAAACTACAAAAAGATAGTTAATGATAAGAAAGAGCCCCTGTTAAATAAATTTCAGACAACCTCTTCCCCAGGATCTACTCAGAAATTAATAACATCTATCATAGGTTTGAAAAATGGGACTATAGACGCATCAACCAGCTACAACATAGTAACTAAGGGATGGCAGAGAAATTCTTCATGGGGAGGATATGAAGTTACAAGGTTTGAGGAAGTTAATGGAGATATTGATTTAGAAAAAGCGATAGCACATTCTGATAATATATTTTTTGCAAGAGCTACCCTCGATATGGGTTCCGAAAAATTTATTAAGGGCATGAAAGCTTTAGACATTGGGAGAAATATTCCTTCTGATTATTATTTTCAAAAAGGACAAATTGCAAATCCAGAAAGTTTAAAAAATAATTTTAAAAATGAAATATTACTAGCTGATTCAGGATATGGCCAGGGAGAAATACTTATAAGTCCAGTACAAATATTATCTATTTATAGTTCTTTAATTAATGAAGGTAAAATGATGAAACCTAAATTATTTGAAACAACAAAAGAAGATATTTGGAAAAATCATATTATTTCAAAAGATGACGTAGATATATTAACAAGAAGCATGAGAAAAGTAGTTACTGGGACACATAGATTGGATGCAGAAAGAAATTATGCACAGTTTGCTGGAAAAACTGGCACTGCAGAATTGAAAACCTCTAGAGAAGAGGGGTTAGGAGCTCAAATCGGTTGGTTTGTTGGATATGATCAAAATAATCCCAATATGATGTTAGGTATAAGTGTGAAGAATGTAGAGAATAAAGGTATGTCGAGTTATAATGCAAGAAAGTTTGCCGAGATAATGGATGAATTATATGAAAATGGAACGAAAAAATATGAAATAGATAGGTGA UPDATED partial with 0 UPDATED NCBI_taxonomy_cvterm_id with 40025 UPDATED NCBI_taxonomy_name with Macrococcus caseolyticus UPDATED NCBI_taxonomy_id with 69966 DELETED 3282 UPDATED ARO_description with mecB encodes an alternative PBP2b protein involved in bacterial cell wall formation. These proteins are acquired by lateral gene transfer and commonly associated with methicillin-resistant Staphylococcus aureus (MRSA). These proteins have lower affinity for penicillin-like antibiotics and therefore are able to perform peptidoglycan synthesis in the presence of beta-lactams. UPDATED category_aro_accession with 3009312 UPDATED category_aro_cvterm_id with 48160 UPDATED category_aro_name with PBP2-like beta-lactam resistant peptidoglycan transpeptidase UPDATED category_aro_description with Peptidoglycan transpeptidase proteins involved in bacterial cell wall formation and which have decreased susceptibility to some beta-lactam antibiotics. These alternative transpeptidases are found in certain organisms, like Staphylococcus aureus, and have lower affinity for penicillin-like antibiotics, such as methicillin. In these organisms, these proteins do not bind to the beta-lactam ring and therefore transpeptidase activity continues in the presence of beta-lactams, thereby conferring resistance to these drugs. These proteins are commonly clinically associated with methicillin-resistant Staphylococcus aureus (MRSA). UPDATED category_aro_class_name with AMR Gene Family DELETED 37589 " 1596 UPDATE OXA-24 OXA-24-like beta-lactamase; monobactam; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1598 UPDATE OXA-101 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1602 UPDATE AAC(6')-Iai AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 1604 UPDATE CTX-M-84 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1606 UPDATE CTX-M-16 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1609 UPDATE QnrC quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 1610 UPDATE OXA-74 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1612 UPDATE ErmR Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35925 " 1614 UPDATE TEM-194 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1615 UPDATE APH(2'')-IIa APH(2''); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 40307 " 1616 UPDATE CTX-M-152 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1617 UPDATE vanE glycopeptide resistance gene cluster; Van ligase; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 1618 UPDATE OXA-362 OXA-134-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1620 UPDATE CTX-M-156 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1505 UPDATE SAT-4 streptothricin acetyltransferase (SAT); nucleoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35931 " 1608 UPDATE MexT resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; fluoroquinolone antibiotic; diaminopyrimidine antibiotic; phenicol antibiotic; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35954 " 1523 UPDATE MexD resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; fluoroquinolone antibiotic; aminoglycoside antibiotic; cephalosporin; penicillin beta-lactam; tetracycline antibiotic; aminocoumarin antibiotic; diaminopyrimidine antibiotic; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 35925 " 1584 UPDATE tet(41) major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 1624 UPDATE lmrD ATP-binding cassette (ABC) antibiotic efflux pump; lincosamide antibiotic; antibiotic efflux; ARO_category "DELETED 36298 " 1625 UPDATE OXA-179 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1626 UPDATE vgaE vga-type ABC-F protein; lincosamide antibiotic; streptogramin antibiotic; pleuromutilin antibiotic; antibiotic target protection; ARO_category "DELETED 35983 " 1627 UPDATE CTX-M-95 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1629 UPDATE TEM-197 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1631 UPDATE CTX-M-71 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1632 UPDATE CTX-M-53 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1633 UPDATE catQ chloramphenicol acetyltransferase (CAT); phenicol antibiotic; antibiotic inactivation; ARO_category "DELETED 36521 " 1509 UPDATE vanX gene in vanF cluster vanX; glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 1547 UPDATE vanR gene in vanC cluster glycopeptide resistance gene cluster; vanR; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 1552 UPDATE MUS-1 MUS beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35981 " 1566 UPDATE vanX gene in vanD cluster vanX; glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 1570 UPDATE OprA resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; fluoroquinolone antibiotic; aminoglycoside antibiotic; carbapenem; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35925 " 1571 UPDATE vanS gene in vanE cluster vanS; glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 1636 UPDATE QnrB57 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 1641 UPDATE OXA-203 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1642 UPDATE clbC Cfr-like 23S rRNA methyltransferase; lincosamide antibiotic; streptogramin antibiotic; oxazolidinone antibiotic; phenicol antibiotic; pleuromutilin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Cfr-like 23S rRNA methyltransferase DELETED 35964 " 1643 UPDATE arnA pmr phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36593 " 1646 UPDATE TEM-139 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1648 UPDATE CTX-M-2 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1651 UPDATE AAC(6')-If AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 1561 UPDATE vanT gene in vanG cluster glycopeptide resistance gene cluster; vanT; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 1635 UPDATE vanR gene in vanG cluster glycopeptide resistance gene cluster; vanR; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 1553 UPDATE tet(S) tetracycline-resistant ribosomal protection protein; tetracycline antibiotic; antibiotic target protection; ARO_category "DELETED 35968 " 1653 UPDATE AAC(6')-Ip AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 1655 UPDATE TEM-117 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1656 UPDATE CTX-M-79 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1657 UPDATE AAC(6')-IIa AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 1659 UPDATE OXA-258 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 1660 UPDATE OXA-375 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1663 UPDATE ACC-1 ACC beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35976 " 1664 UPDATE adeK resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; fluoroquinolone antibiotic; lincosamide antibiotic; carbapenem; cephalosporin; penicillin beta-lactam; tetracycline antibiotic; rifamycin antibiotic; diaminopyrimidine antibiotic; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 1665 UPDATE ramA resistance-nodulation-cell division (RND) antibiotic efflux pump; General Bacterial Porin with reduced permeability to beta-lactams; antibiotic efflux regulatory protein; fluoroquinolone antibiotic; monobactam; carbapenem; cephalosporin; glycylcycline; penicillin beta-lactam; tetracycline antibiotic; rifamycin antibiotic; phenicol antibiotic; disinfecting agents and antiseptics; antibiotic efflux; reduced permeability to antibiotic; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35949 " 1667 UPDATE TEM-80 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1672 UPDATE TEM-211 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1673 UPDATE QnrA6 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 1674 UPDATE AAC(6')-It AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 1675 UPDATE CTX-M-5 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1679 UPDATE OXA-49 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1680 UPDATE macA ATP-binding cassette (ABC) antibiotic efflux pump; macrolide antibiotic; antibiotic efflux; ARO_category "DELETED 35925 " 1681 UPDATE APH(4)-Ib APH(4); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 36353 " 1682 UPDATE aadA24 ANT(3''); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35957 " 1683 UPDATE QnrB67 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 1686 UPDATE OXA-34 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 1688 UPDATE CTX-M-90 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1690 UPDATE OXA-317 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1693 UPDATE TEM-143 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1694 UPDATE OXA-353 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1697 UPDATE TEM-135 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36981 " 1701 UPDATE Erm(39) Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35925 " 1703 UPDATE FosK fosfomycin thiol transferase; phosphonic acid antibiotic; antibiotic inactivation; ARO_category "DELETED 35944 " 1706 UPDATE OXA-142 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1707 UPDATE QnrB4 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 1709 UPDATE TEM-115 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1714 UPDATE ErmW Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35925 " 1715 UPDATE OXA-73 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1716 UPDATE OXA-398 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1717 UPDATE OXA-230 OXA-229-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1719 UPDATE ceoA resistance-nodulation-cell division (RND) antibiotic efflux pump; fluoroquinolone antibiotic; aminoglycoside antibiotic; antibiotic efflux; ARO_category "DELETED 36298 " 1720 UPDATE tap major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 1722 UPDATE TEM-184 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1725 UPDATE TEM-101 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1728 UPDATE OXA-42 OXA-42-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1729 UPDATE CTX-M-66 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1730 UPDATE OXA-235 OXA-134-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1731 UPDATE mphB macrolide phosphotransferase (MPH); macrolide antibiotic; antibiotic inactivation; ARO_category "DELETED 35925 " 1733 UPDATE OXA-415 OXA-2-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1735 UPDATE vatA streptogramin vat acetyltransferase; streptogramin antibiotic; antibiotic inactivation; ARO_category "DELETED 37013 " 1737 UPDATE ANT(4')-Ia ANT(4'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 1738 UPDATE CTX-M-45 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1740 UPDATE TEM-53 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1741 UPDATE OXA-359 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1743 UPDATE OXA-338 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1744 UPDATE cmrA major facilitator superfamily (MFS) antibiotic efflux pump; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 36524 " 1748 UPDATE lsaC lsa-type ABC-F protein; lincosamide antibiotic; streptogramin antibiotic; pleuromutilin antibiotic; antibiotic target protection; ARO_category "DELETED 35964 " 1750 UPDATE OXA-254 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1751 UPDATE Erm(33) Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35925 " 1754 UPDATE vanO glycopeptide resistance gene cluster; Van ligase; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 1755 UPDATE CTX-M-23 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1757 UPDATE emrA major facilitator superfamily (MFS) antibiotic efflux pump; fluoroquinolone antibiotic; antibiotic efflux; ARO_category "DELETED 37005 " 1758 UPDATE OXA-326 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1759 UPDATE vanF glycopeptide resistance gene cluster; Van ligase; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 1760 UPDATE QnrB35 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 1761 UPDATE OXA-351 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1762 UPDATE aadA16 ANT(3''); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35957 " 1764 UPDATE OXA-97 OXA-58-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1765 UPDATE OXA-56 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1768 UPDATE CTX-M-144 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1769 UPDATE CTX-M-115 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1770 UPDATE TEM-127 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1771 UPDATE TEM-19 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1772 UPDATE aadA11 ANT(3''); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35957 " 1774 UPDATE CTX-M-106 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1775 UPDATE QnrS7 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 1777 UPDATE OXA-177 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1779 UPDATE CTX-M-12 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1780 UPDATE OXA-146 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1607 UPDATE Streptococcus pneumoniae PBP1a conferring resistance to amoxicillin penicillin-binding protein with mutation conferring resistance to beta-lactam antibiotics; monobactam; cephalosporin; penicillin beta-lactam; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 0000004 UPDATED category_aro_cvterm_id with 35923 UPDATED category_aro_name with monobactam UPDATED category_aro_description with Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_name with penicillin-binding protein with mutation conferring resistance to beta-lactam antibiotics DELETED 35981 " 1773 UPDATE tet(43) major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 1781 UPDATE AAC(2')-Ia AAC(2'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 1782 UPDATE TEM-12 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1784 UPDATE OXA-334 OXA-211-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1785 UPDATE TEM-48 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1786 UPDATE mexY resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; fluoroquinolone antibiotic; aminoglycoside antibiotic; carbapenem; cephalosporin; penicillin beta-lactam; tetracycline antibiotic; phenicol antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 35925 " 1789 UPDATE QnrB44 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 1791 UPDATE TEM-164 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1666 UPDATE vanX gene in vanB cluster vanX; glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 1752 UPDATE MdtK multidrug and toxic compound extrusion (MATE) transporter; fluoroquinolone antibiotic; antibiotic efflux; ARO_category "DELETED 35954 " 1790 UPDATE vanH gene in vanF cluster vanH; glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 1678 UPDATE AAC(6')-Ib-cr1 AAC(6'); AAC(6')-Ib-cr; fluoroquinolone antibiotic; aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35932 " 1794 UPDATE tmrB tunicamycin resistance protein; nucleoside antibiotic; reduced permeability to antibiotic; ARO_category "DELETED 35928 " 1797 UPDATE ErmY Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35925 " 1799 UPDATE TEM-147 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1801 UPDATE AAC(6')-Ib11 AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35932 " 1802 UPDATE OXA-168 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1803 UPDATE QnrVC3 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 1804 UPDATE OXA-107 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1805 UPDATE TEM-131 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1806 UPDATE OXA-14 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1807 UPDATE OXA-70 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1809 UPDATE QnrB5 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 1699 UPDATE vanX gene in vanO cluster vanX; glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 1713 UPDATE vanY gene in vanM cluster vanY; glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 1692 UPDATE tet(M) tetracycline-resistant ribosomal protection protein; tetracycline antibiotic; antibiotic target protection; ARO_category "DELETED 35968 " 1708 UPDATE tet(36) tetracycline-resistant ribosomal protection protein; tetracycline antibiotic; antibiotic target protection; ARO_category "DELETED 35968 " 1815 UPDATE CTX-M-134 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1816 UPDATE TEM-8 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1817 UPDATE vgaB vga-type ABC-F protein; streptogramin antibiotic; pleuromutilin antibiotic; antibiotic target protection; ARO_category "DELETED 37013 " 1819 UPDATE TEM-3 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1820 UPDATE bacA undecaprenyl pyrophosphate related proteins; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35959 " 1821 UPDATE AAC(6')-Ir AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 1824 UPDATE oleI ole glycosyltransferase; macrolide antibiotic; antibiotic inactivation; ARO_category "DELETED 37247 " 1825 UPDATE CTX-M-27 CTX-M beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class DELETED 35975 " 1826 UPDATE ykkC small multidrug resistance (SMR) antibiotic efflux pump; aminoglycoside antibiotic; tetracycline antibiotic; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 35958 " 1830 UPDATE APH(3'')-Ib APH(3''); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35958 " 1831 UPDATE AAC(6')-Iid AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 1832 UPDATE QnrS2 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 1833 UPDATE OXA-374 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1834 UPDATE TEM-94 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1836 UPDATE OXA-201 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1837 UPDATE CTX-M-59 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1839 UPDATE aadA14 ANT(3''); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35957 " 1841 UPDATE OXA-76 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1842 UPDATE IMI-3 IMI beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 0000032 UPDATED category_aro_cvterm_id with 35951 UPDATED category_aro_name with cephalosporin UPDATED category_aro_description with Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000008 UPDATED category_aro_cvterm_id with 36017 UPDATED category_aro_name with penicillin beta-lactam UPDATED category_aro_description with Penicilins (Penams) are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. Penicillin-like antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_class_name with Drug Class " 1843 UPDATE rmtD 16S rRNA methyltransferase (G1405); aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35932 " 1844 UPDATE OXA-128 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1845 UPDATE OXA-312 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1846 UPDATE CTX-M-91 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1847 UPDATE emrB major facilitator superfamily (MFS) antibiotic efflux pump; fluoroquinolone antibiotic; antibiotic efflux; ARO_category "DELETED 37005 " 1848 UPDATE CTX-M-75 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1850 UPDATE FomB Fom phosphotransferase family; phosphonic acid antibiotic; antibiotic inactivation; ARO_category "DELETED 35944 " 1852 UPDATE rmtF 16S rRNA methyltransferase (G1405); aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35922 " 1853 UPDATE OXA-20 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 1854 UPDATE rmtA 16S rRNA methyltransferase (G1405); aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35926 " 1855 UPDATE CTX-M-72 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1856 UPDATE QnrB20 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 1858 UPDATE OXA-387 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1859 UPDATE QnrVC7 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 1860 UPDATE OXA-165 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1862 UPDATE OXA-109 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1865 UPDATE ACC-5 ACC beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1867 UPDATE CTX-M-116 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1868 UPDATE TEM-82 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1870 UPDATE OXA-66 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1871 UPDATE OXA-389 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1873 UPDATE linG lincosamide nucleotidyltransferase (LNU); lincosamide antibiotic; antibiotic inactivation; ARO_category "DELETED 35964 " 1874 UPDATE OXA-196 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1879 UPDATE AAC(3)-IIIa AAC(3); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35924 " 1880 UPDATE adeN resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; macrolide antibiotic; fluoroquinolone antibiotic; lincosamide antibiotic; carbapenem; cephalosporin; penicillin beta-lactam; tetracycline antibiotic; rifamycin antibiotic; diaminopyrimidine antibiotic; phenicol antibiotic; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35968 " 1881 UPDATE OXA-72 OXA-24-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1882 UPDATE OXA-80 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1884 UPDATE CTX-M-111 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1887 UPDATE TEM-70 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1889 UPDATE NDM-4 NDM beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 40523 " 1890 UPDATE TEM-86 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1891 UPDATE AAC(6')-Iih AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 1892 UPDATE OXA-114a OXA-114-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1898 UPDATE OXA-379 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1901 UPDATE CTX-M-51 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1902 UPDATE OXA-246 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1903 UPDATE mdtE resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; fluoroquinolone antibiotic; penicillin beta-lactam; antibiotic efflux; ARO_category "DELETED 35925 " 1906 UPDATE CTX-M-17 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1909 UPDATE AAC(6')-Iak AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 1910 UPDATE CTX-M-136 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1911 UPDATE AAC(6')-Iad AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 1913 UPDATE dfrK trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 1916 UPDATE TEM-208 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1918 UPDATE spd ANT(9); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35957 " 1921 UPDATE EreB macrolide esterase; macrolide antibiotic; antibiotic inactivation; ARO_category "DELETED 35925 " 1922 UPDATE marA resistance-nodulation-cell division (RND) antibiotic efflux pump; General Bacterial Porin with reduced permeability to beta-lactams; antibiotic efflux regulatory protein; fluoroquinolone antibiotic; monobactam; carbapenem; cephalosporin; glycylcycline; penicillin beta-lactam; tetracycline antibiotic; rifamycin antibiotic; phenicol antibiotic; disinfecting agents and antiseptics; antibiotic efflux; reduced permeability to antibiotic; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35949 " 1923 UPDATE APH(3'')-Ia APH(3''); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35958 " 1924 UPDATE vanM glycopeptide resistance gene cluster; Van ligase; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 1928 UPDATE OXA-50 OXA-50-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1930 UPDATE CTX-M-29 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1931 UPDATE TEM-150 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1934 UPDATE lnuD lincosamide nucleotidyltransferase (LNU); lincosamide antibiotic; antibiotic inactivation; ARO_category "DELETED 35964 " 1936 UPDATE CTX-M-43 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1937 UPDATE OXA-118 OXA-46-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1938 UPDATE mtrD resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; antibiotic efflux; ARO_category "DELETED 35925 " 1939 UPDATE AAC(6')-Ix AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 1940 UPDATE QnrB30 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 1925 UPDATE MexB resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; fluoroquinolone antibiotic; monobactam; carbapenem; cephalosporin; penicillin beta-lactam; tetracycline antibiotic; peptide antibiotic; aminocoumarin antibiotic; diaminopyrimidine antibiotic; sulfonamide antibiotic; phenicol antibiotic; nonribosomal peptide antibiotics; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 0010004 UPDATED category_aro_cvterm_id with 36005 UPDATED category_aro_name with resistance-nodulation-cell division (RND) antibiotic efflux pump UPDATED category_aro_description with Directed pumping of antibiotic out of a cell to confer resistance. Resistance-nodulation-division (RND) proteins are found in both prokaryotic and eukaryotic cells and have diverse substrate specificities and physiological roles. However, there are relatively few RND transporters and they are secondary transporters, energized not by ATP binding/hydrolysis but by proton movement down the transmembrane electrochemical gradient. UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_accession with 0000000 UPDATED category_aro_cvterm_id with 35919 UPDATED category_aro_name with macrolide antibiotic UPDATED category_aro_description with Macrolides are a group of drugs (typically antibiotics) that have a large macrocyclic lactone ring of 12-16 carbons to which one or more deoxy sugars, usually cladinose and desosamine, may be attached. Macrolides bind to the 50S-subunit of bacterial ribosomes, inhibiting the synthesis of vital proteins. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 0000001 UPDATED category_aro_cvterm_id with 35920 UPDATED category_aro_name with fluoroquinolone antibiotic UPDATED category_aro_description with The fluoroquinolones are a family of synthetic broad-spectrum antibiotics that are 4-quinolone-3-carboxylates. These compounds interact with topoisomerase II (DNA gyrase) to disrupt bacterial DNA replication, damage DNA, and cause cell death. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 0000004 UPDATED category_aro_cvterm_id with 35923 UPDATED category_aro_name with monobactam UPDATED category_aro_description with Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 0000020 UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_name with carbapenem UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 0000032 UPDATED category_aro_cvterm_id with 35951 UPDATED category_aro_name with cephalosporin UPDATED category_aro_description with Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000008 UPDATED category_aro_cvterm_id with 36017 UPDATED category_aro_name with penicillin beta-lactam UPDATED category_aro_description with Penicilins (Penams) are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. Penicillin-like antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000050 UPDATED category_aro_cvterm_id with 36189 UPDATED category_aro_name with tetracycline antibiotic UPDATED category_aro_description with These antibiotics are derived from tetracycline, a polyketide antibiotic that inhibits the 30S subunit of bacterial ribosomes. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000103 UPDATED category_aro_cvterm_id with 36242 UPDATED category_aro_name with aminocoumarin antibiotic UPDATED category_aro_description with Aminocoumarin antibiotics bind DNA gyrase subunit B to inhibit ATP-dependent DNA supercoiling. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000171 UPDATED category_aro_cvterm_id with 36310 UPDATED category_aro_name with diaminopyrimidine antibiotic UPDATED category_aro_description with Diaminopyrimidines are a class of organic compounds containing a pyrimidine ring substituted by two amine groups. They are inhibitors of dihydrofolate reductase, an enzyme critical for DNA synthesis. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000282 UPDATED category_aro_cvterm_id with 36421 UPDATED category_aro_name with sulfonamide antibiotic UPDATED category_aro_description with Sulfonamides are broad spectrum, synthetic antibiotics that contain the sulfonamide group. Sulfonamides inhibit dihydropteroate synthase, which catalyzes the conversion of p-aminobenzoic acid to dihydropteroic acid as part of the tetrahydrofolic acid biosynthetic pathway. Tetrahydrofolic acid is essential for folate synthesis, a precursor of many nucleotides and amino acids. Many sulfamides are taken with trimethoprim, an inhibitor of dihydrofolate reductase, also disturbing the trihydrofolic acid synthesis pathway. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000387 UPDATED category_aro_cvterm_id with 36526 UPDATED category_aro_name with phenicol antibiotic UPDATED category_aro_description with Phenicols are broad spectrum bacteriostatic antibiotics acting on bacterial protein synthesis. More specifically, the phenicols block peptide elongation by binding to the peptidyltansferase centre of the 70S ribosome. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36298 " 1917 UPDATE tet(30) major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 1835 UPDATE tet(38) major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 1808 UPDATE tet(A) major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 1885 UPDATE tet(Z) major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; model_sequences; ARO_category "UPDATED accession with WP_064190967.1 UPDATED sequence with MHFIIDNFILDKVTARYSHLTARYSHRGILTAVLITATLDAAGLGLVMPILPTLLDQVGAPDDMIPLHVGLLTALYAIMQFLCAPILGRLSDRFGRRRVLVASLAGATIDYLVLALTDTLWVFYLARAVAGITGATNAVTATVIADITPPDQRAKRYGWLGACYGGGMIAGPAIGGLFGGVSPHLPFLVAAALAGITLVLSASLLRETRPPGSNGSHAQQPGTAKRTAVPGMLILLAVFGIVQFIGQAPGSTWVLFTQQRLDWNPVEVGVSLSIFGMVQVFVQAALTGRIVSRIGETRAILVGIAADAIGLIGLALIASTWAMLPILAALGLGSITLPALQTLLSRRAPEQQQGRLQGTLASLNSLTSIIGPVTFTGIFALTRTNADGTLWICAAALYVLCALLMIRETCASRRSR UPDATED accession with NG_048311.1 UPDATED fmin with 100 UPDATED fmax with 1351 UPDATED strand with + UPDATED sequence with TTGCACTTTATCATCGATAACTTTATCTTAGATAAAGTGACTGCTCGCTACTCTCATCTGACTGCTCGCTACTCTCATCGTGGAATCCTGACAGCCGTGCTCATCACGGCGACCCTCGATGCTGCAGGGCTGGGCCTCGTGATGCCGATCTTGCCTACCCTTCTCGACCAGGTCGGTGCCCCCGACGACATGATCCCACTGCACGTCGGACTACTGACAGCGCTCTATGCGATCATGCAGTTTCTTTGCGCCCCGATCCTTGGCCGACTCTCTGACCGTTTCGGACGCCGCCGCGTGCTTGTCGCCTCCCTCGCAGGCGCGACGATCGACTACCTCGTGCTCGCACTGACGGACACGCTGTGGGTCTTTTACCTCGCCCGCGCGGTTGCAGGCATTACCGGCGCCACGAACGCCGTCACCGCGACGGTGATCGCCGACATTACTCCGCCGGATCAGCGCGCAAAACGCTACGGGTGGCTCGGCGCATGCTACGGCGGTGGCATGATCGCGGGTCCCGCCATTGGCGGTCTTTTCGGCGGGGTCTCACCGCATCTGCCATTCCTCGTCGCCGCCGCGCTCGCCGGAATCACCCTCGTACTCAGCGCGAGTCTTCTGCGTGAGACGCGGCCACCGGGCAGCAACGGCTCGCACGCACAGCAACCCGGTACGGCGAAGCGAACCGCAGTGCCGGGGATGCTTATCCTTCTCGCAGTCTTCGGCATCGTGCAGTTCATCGGCCAAGCACCAGGCTCCACCTGGGTGCTCTTCACGCAGCAGCGCCTCGACTGGAACCCCGTCGAAGTCGGCGTTTCGCTATCCATCTTCGGAATGGTGCAAGTATTCGTGCAGGCGGCACTGACCGGACGCATCGTGTCCCGGATCGGCGAGACCCGGGCGATCCTCGTCGGTATCGCCGCAGACGCCATTGGGCTCATCGGCCTTGCCCTCATCGCCAGCACATGGGCGATGCTACCGATCCTCGCAGCGCTCGGACTCGGCAGCATCACGTTGCCCGCACTGCAGACGCTGCTCTCGAGACGCGCGCCCGAGCAGCAGCAGGGACGCCTGCAGGGAACACTTGCAAGCCTGAACAGCCTCACCTCGATCATCGGCCCGGTCACCTTCACCGGCATTTTCGCACTCACCCGAACGAATGCAGACGGCACCCTCTGGATCTGCGCCGCAGCGCTCTACGTTCTCTGCGCCCTCCTGATGATCCGTGAGACATGCGCCTCACGGCGATCTCGATAA UPDATED partial with 0 UPDATED NCBI_taxonomy_cvterm_id with 36777 UPDATED NCBI_taxonomy_name with Corynebacterium glutamicum UPDATED NCBI_taxonomy_id with 1718 DELETED 5588 DELETED 35968 " 1944 UPDATE CTX-M-148 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1946 UPDATE CTX-M-10 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1947 UPDATE CTX-M-160 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1948 UPDATE TEM-167 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1950 UPDATE arr-1 rifampin ADP-ribosyltransferase (Arr); rifamycin antibiotic; antibiotic inactivation; ARO_category "DELETED 36308 " 1951 UPDATE TEM-76 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1952 UPDATE OXA-1 OXA-1-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1954 UPDATE TEM-154 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1955 UPDATE OXA-29 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 1956 UPDATE IMI-1 IMI beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 0000032 UPDATED category_aro_cvterm_id with 35951 UPDATED category_aro_name with cephalosporin UPDATED category_aro_description with Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000008 UPDATED category_aro_cvterm_id with 36017 UPDATED category_aro_name with penicillin beta-lactam UPDATED category_aro_description with Penicilins (Penams) are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. Penicillin-like antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_class_name with Drug Class " 1899 UPDATE vanY gene in vanF cluster vanY; glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 1907 UPDATE vanS gene in vanA cluster vanS; glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 1960 UPDATE smeB resistance-nodulation-cell division (RND) antibiotic efflux pump; aminoglycoside antibiotic; cephalosporin; penicillin beta-lactam; antibiotic efflux; ARO_category "DELETED 36298 " 1961 UPDATE TEM-105 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1962 UPDATE OXA-47 OXA-1-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1963 UPDATE TEM-190 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1967 UPDATE OXA-116 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 1971 UPDATE dfrB2 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 1972 UPDATE OXA-149 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1973 UPDATE TEM-111 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1975 UPDATE blt major facilitator superfamily (MFS) antibiotic efflux pump; fluoroquinolone antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 35963 " 1977 UPDATE AAC(6')-Ik AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 1978 UPDATE OXA-200 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1979 UPDATE FosA4 fosfomycin thiol transferase; phosphonic acid antibiotic; antibiotic inactivation; ARO_category "DELETED 35944 " 1980 UPDATE OXA-247 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1981 UPDATE vanA glycopeptide resistance gene cluster; Van ligase; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 1986 UPDATE OXA-309 OXA-211-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1987 UPDATE QnrA1 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 1992 UPDATE dfrA1 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 1993 UPDATE QnrB74 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 1995 UPDATE AAC(6')-Iz AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 1997 UPDATE tlrC Miscellaneous ABC-F subfamily ATP-binding cassette ribosomal protection proteins; macrolide antibiotic; lincosamide antibiotic; antibiotic target protection; ARO_category "DELETED 35964 " 1998 UPDATE CTX-M-83 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 1999 UPDATE TEM-215 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 2000 UPDATE TEM-24 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 2001 UPDATE OXA-250 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2004 UPDATE TEM-189 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 2005 UPDATE CTX-M-89 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 2007 UPDATE OXA-335 OXA-134-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2009 UPDATE aadA6 ANT(3''); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35957 " 2010 UPDATE CTX-M-129 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 2011 UPDATE QnrB60 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 2013 UPDATE Erm(41) Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35925 " 2016 UPDATE OXA-370 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2017 UPDATE CTX-M-37 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 2019 UPDATE OXA-213 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2022 UPDATE CTX-M-104 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 2023 UPDATE OXA-132 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2024 UPDATE ACC-2 ACC beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 2025 UPDATE TEM-57 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 2026 UPDATE OXA-84 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2028 UPDATE QnrB43 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 2029 UPDATE TEM-123 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 2030 UPDATE AAC(3)-IXa AAC(3); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35924 " 2031 UPDATE OXA-173 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2032 UPDATE CTX-M-62 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 2034 UPDATE TEM-108 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 2035 UPDATE CTX-M-15 CTX-M beta-lactamase; cephalosporin; penicillin beta-lactam; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class DELETED 35975 " 2040 UPDATE TEM-60 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 2041 UPDATE OXA-424 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2043 UPDATE aadA8 ANT(3''); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35957 " 2044 UPDATE QnrB31 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 2047 UPDATE OXA-322 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2048 UPDATE OXA-57 OXA-42-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2049 UPDATE QnrB72 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 2050 UPDATE OXA-331 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2051 UPDATE dfrA15 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 2052 UPDATE APH(3'')-Ic APH(3''); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35958 " 2053 UPDATE dfrA7 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 2054 UPDATE msrC msr-type ABC-F protein; macrolide antibiotic; streptogramin antibiotic; antibiotic target protection; ARO_category "DELETED 35925 " 2056 UPDATE mdtO major facilitator superfamily (MFS) antibiotic efflux pump; nucleoside antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 35963 " 2058 UPDATE pp-flo major facilitator superfamily (MFS) antibiotic efflux pump; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 36524 " 2060 UPDATE FosC2 fosC phosphotransferase family; phosphonic acid antibiotic; antibiotic inactivation; ARO_category "DELETED 35944 " 2062 UPDATE mphC macrolide phosphotransferase (MPH); macrolide antibiotic; antibiotic inactivation; ARO_category "DELETED 35925 " 2063 UPDATE blaR1 gene modulating beta-lactam resistance; BlaZ beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3000100 UPDATED category_aro_cvterm_id with 36239 UPDATED category_aro_name with gene modulating beta-lactam resistance UPDATED category_aro_description with Genes that directly or indirectly modulate beta-lactam resistance. UPDATED category_aro_class_name with AMR Gene Family " 2064 UPDATE TEM-196 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 1966 UPDATE lmrA ATP-binding cassette (ABC) antibiotic efflux pump; antibiotic efflux regulatory protein; lincosamide antibiotic; nucleoside antibiotic; antibiotic target alteration; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35964 " 2071 UPDATE AAC(6')-Ib8 AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35932 " 2072 UPDATE NmcR IMI beta-lactamase; gene modulating beta-lactam resistance; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3000100 UPDATED category_aro_cvterm_id with 36239 UPDATED category_aro_name with gene modulating beta-lactam resistance UPDATED category_aro_description with Genes that directly or indirectly modulate beta-lactam resistance. UPDATED category_aro_class_name with AMR Gene Family DELETED 35927 " 2079 UPDATE sgm 16S rRNA methyltransferase (G1405); aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35926 " 2081 UPDATE patA ATP-binding cassette (ABC) antibiotic efflux pump; fluoroquinolone antibiotic; antibiotic efflux; ARO_category "DELETED 35954 " 2087 UPDATE aadA13 ANT(3''); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35957 " 2112 UPDATE patB ATP-binding cassette (ABC) antibiotic efflux pump; fluoroquinolone antibiotic; antibiotic efflux; ARO_category "DELETED 35954 " 2114 UPDATE APH(3')-IIa APH(3'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35924 " 2115 UPDATE TEM-4 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 2117 UPDATE AAC(6')-Ib7 AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35932 " 2123 UPDATE vgaC vga-type ABC-F protein; lincosamide antibiotic; streptogramin antibiotic; pleuromutilin antibiotic; antibiotic target protection; ARO_category "DELETED 35964 " 2130 UPDATE opcM resistance-nodulation-cell division (RND) antibiotic efflux pump; fluoroquinolone antibiotic; aminoglycoside antibiotic; antibiotic efflux; ARO_category "DELETED 36298 " 3451 UPDATE OXA-287 OXA-286-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 29 UPDATE Escherichia coli folP with mutation conferring resistance to sulfonamides sulfonamide resistant dihydropteroate synthase folP; sulfonamide antibiotic; antibiotic target alteration; ARO_category "DELETED 36463 " 1994 UPDATE gimA gimA family macrolide glycosyltransferase; macrolide antibiotic; antibiotic inactivation; ARO_category "DELETED 36284 " 2003 UPDATE pmrA major facilitator superfamily (MFS) antibiotic efflux pump; fluoroquinolone antibiotic; antibiotic efflux; ARO_category "DELETED 35954 " 2046 UPDATE tet(33) major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 1969 UPDATE tet(35) ATP-binding cassette (ABC) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 2002 UPDATE Bacillus pumilus cat86 chloramphenicol acetyltransferase (CAT); phenicol antibiotic; antibiotic inactivation; ARO_category "DELETED 36521 " 2033 UPDATE mtrR major facilitator superfamily (MFS) antibiotic efflux pump; resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; macrolide antibiotic; antibacterial free fatty acids; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35925 " 90 UPDATE Staphylococcus aureus rpoB mutants conferring resistance to rifampicin rifamycin-resistant beta-subunit of RNA polymerase (rpoB); rifamycin antibiotic; antibiotic target alteration; antibiotic target replacement; ARO_category "DELETED 36308 " 111 UPDATE Escherichia coli gyrB conferring resistance to aminocoumarin aminocoumarin resistant gyrB; aminocoumarin antibiotic; antibiotic target alteration; ARO_category "DELETED 36250 " 335 UPDATE Staphylococcus aureus parE conferring resistance to fluoroquinolones fluoroquinolone resistant parE; fluoroquinolone antibiotic; antibiotic target alteration; ARO_category "DELETED 35942 " 462 UPDATE Staphylococcus aureus pgsA mutations conferring resistance to daptomycin daptomycin resistant pgsA; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35985 " 489 UPDATE Mycobacterium tuberculosis gidB mutation conferring resistance to streptomycin antibiotic resistant gidB; aminoglycoside antibiotic; antibiotic target alteration; model_param; ARO_category "UPDATED 2676 with A200E DELETED 15756 UPDATED 19367 with V188M UPDATED 19368 with V188M UPDATED 19369 with V188M UPDATED 19370 with V188M UPDATED 19371 with V188M UPDATED 19373 with V188M UPDATED 19375 with V188M UPDATED 19376 with V188M UPDATED 19377 with V188M UPDATED 19378 with V188M UPDATED 19379 with V188M UPDATED 19380 with V188M UPDATED 19381 with V188M UPDATED 19382 with V188M UPDATED 19383 with V188M UPDATED 19386 with V188M UPDATED 19387 with V188M UPDATED 19389 with V188M UPDATED 19426 with V188M UPDATED 19427 with V188M UPDATED 19428 with V188M UPDATED 19429 with V188M UPDATED 19430 with V188M UPDATED 19431 with V188M UPDATED 19432 with V188M UPDATED 19433 with V188M UPDATED 19434 with V188M UPDATED 19435 with V188M UPDATED 19436 with V188M UPDATED 19437 with V188M UPDATED 19438 with V188M UPDATED 19439 with V188M UPDATED 19374 with V188G UPDATED 19355 with V188G UPDATED 19356 with V188G UPDATED 19357 with V188G UPDATED 19358 with V188G UPDATED 19359 with V188G UPDATED 19360 with V188G UPDATED 19361 with V188G UPDATED 19362 with V188G UPDATED 19363 with V188G UPDATED 19364 with V188G UPDATED 19365 with V188G UPDATED 19366 with V188G UPDATED 19409 with V188G UPDATED 19410 with V188G UPDATED 19411 with V188G UPDATED 19404 with G30R UPDATED 19405 with G30R UPDATED 19406 with G30R UPDATED 19408 with G30R UPDATED 19413 with G30R UPDATED 19390 with S70N UPDATED 19391 with S70N UPDATED 19392 with S70N UPDATED 19394 with S70N UPDATED 19395 with S70N UPDATED 19396 with S70N UPDATED 19398 with S70N UPDATED 19399 with S70N UPDATED 19400 with S70N UPDATED 19401 with S70N UPDATED 19402 with S70N UPDATED 19403 with S70N UPDATED 19414 with S70N UPDATED 19415 with S70N UPDATED 19416 with S70N UPDATED 19417 with S70N UPDATED 19418 with S70N UPDATED 19420 with S70N UPDATED 19421 with S70N UPDATED 19422 with S70N UPDATED 19423 with S70N UPDATED 19424 with S70N UPDATED 19425 with S70N UPDATED 19397 with S70N UPDATED 19348 with S70N UPDATED 19349 with S70N UPDATED 19350 with S70N UPDATED 19351 with S70N UPDATED 19352 with S70N UPDATED 19353 with S70N UPDATED 19320 with S70N UPDATED 19321 with S70N UPDATED 19322 with S70N UPDATED 19323 with S70N UPDATED 19324 with S70N UPDATED 19325 with S70N UPDATED 19326 with S70N UPDATED 19327 with S70N UPDATED 19328 with S70N UPDATED 19329 with S70N UPDATED 19330 with S70N UPDATED 19331 with S70N UPDATED 19332 with S70N UPDATED 19333 with S70N UPDATED 19335 with S70N UPDATED 19336 with S70N UPDATED 19337 with S70N UPDATED 19338 with S70N UPDATED 19339 with S70N UPDATED 19340 with S70N UPDATED 19341 with S70N UPDATED 19342 with S70N UPDATED 19343 with S70N UPDATED 19344 with S70N UPDATED 19347 with S70N UPDATED 15750 with V59N UPDATED 15751 with V59N UPDATED 15759 with V59N UPDATED 15768 with V59N UPDATED 15775 with V59N UPDATED 15779 with V59N UPDATED 15782 with V59N UPDATED 15786 with V59N UPDATED 15794 with A200E UPDATED 15802 with V59N UPDATED 15806 with V59N UPDATED 15821 with V59N UPDATED 15830 with V59N UPDATED 15831 with A200E UPDATED 15836 with V59N UPDATED 15837 with V59N UPDATED 15856 with V59N UPDATED 15857 with V59N UPDATED 15863 with V59N UPDATED 15877 with A200E UPDATED 15889 with V59N UPDATED 15907 with V59N UPDATED 15920 with V59N UPDATED 15928 with V59N UPDATED 15953 with V59N UPDATED 15958 with S70N UPDATED 15978 with V59N UPDATED 15984 with V59N UPDATED 15989 with V59N UPDATED 15999 with V59N UPDATED 16001 with V59N UPDATED 16008 with V59N UPDATED 16017 with V59N UPDATED 3677 with V59N UPDATED 9842 with S70N DELETED param_type UPDATED 19367 with G129fs UPDATED 19368 with G164fs UPDATED 19369 with G17fs UPDATED 19370 with G182fs UPDATED 19371 with G192fs UPDATED 19373 with G30fs UPDATED 19375 with G69fs UPDATED 19376 with G71fs UPDATED 19377 with G76fs UPDATED 19378 with H168fs UPDATED 19379 with H174fs UPDATED 19380 with H48fs UPDATED 19381 with I114fs UPDATED 19382 with I11fs UPDATED 19383 with I179fs UPDATED 19386 with I81fs UPDATED 19387 with L108fs UPDATED 19389 with L152fs UPDATED 19426 with V115fs UPDATED 19427 with V124fs UPDATED 19428 with V135fs UPDATED 19429 with V184fs UPDATED 19430 with V188fs UPDATED 19431 with V189fs UPDATED 19432 with V202fs UPDATED 19433 with V36fs UPDATED 19434 with V41fs UPDATED 19435 with V54fs UPDATED 19436 with V65fs UPDATED 19437 with V66fs UPDATED 19438 with V77fs UPDATED 19439 with V88fs UPDATED 19374 with G37fs UPDATED 19355 with D67fs UPDATED 19356 with C191fs UPDATED 19357 with Q125fs UPDATED 19358 with Q210fs UPDATED 19359 with Q87fs UPDATED 19360 with E120fs UPDATED 19361 with E121fs UPDATED 19362 with E32fs UPDATED 19363 with E60fs UPDATED 19364 with E92fs UPDATED 19365 with G109fs UPDATED 19366 with G117fs UPDATED 19409 with P151fs UPDATED 19410 with P29fs UPDATED 19411 with P38fs UPDATED 19404 with M159fs UPDATED 19405 with M178fs UPDATED 19406 with F100fs UPDATED 19408 with P14fs UPDATED 19413 with P84fs UPDATED 19390 with L16fs UPDATED 19391 with L26fs UPDATED 19392 with L35fs UPDATED 19394 with L50fs UPDATED 19395 with L59fs UPDATED 19396 with L74fs UPDATED 19398 with L86fs UPDATED 19399 with L90fs UPDATED 19400 with L91fs UPDATED 19401 with L95fs UPDATED 19402 with K147fs UPDATED 19403 with M104fs UPDATED 19414 with P93fs UPDATED 19415 with S122fs UPDATED 19416 with S136fs UPDATED 19417 with S149fs UPDATED 19418 with S220fs UPDATED 19420 with T106fs UPDATED 19421 with T201fs UPDATED 19422 with T98fs UPDATED 19423 with W148fs UPDATED 19424 with V105fs UPDATED 19425 with V110fs UPDATED 19397 with L79fs UPDATED 19348 with R97fs UPDATED 19349 with N194fs UPDATED 19350 with D107fs UPDATED 19351 with D185fs UPDATED 19352 with D46fs UPDATED 19353 with D63fs UPDATED 19320 with A119fs UPDATED 19321 with A133fs UPDATED 19322 with A134fs UPDATED 19323 with A138fs UPDATED 19324 with A140fs UPDATED 19325 with A167fs UPDATED 19326 with A183fs UPDATED 19327 with A193fs UPDATED 19328 with A19fs UPDATED 19329 with A200fs UPDATED 19330 with A205fs UPDATED 19331 with A82fs UPDATED 19332 with R102fs UPDATED 19333 with R116fs UPDATED 19335 with R118fs UPDATED 19336 with R158fs UPDATED 19337 with R15fs UPDATED 19338 with R176fs UPDATED 19339 with R206fs UPDATED 19340 with R21fs UPDATED 19341 with R33fs UPDATED 19342 with R39fs UPDATED 19343 with R43fs UPDATED 19344 with R64fs UPDATED 19347 with R83fs DELETED 35958 " 2138 UPDATE NmcA IMI beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35927 " 2014 UPDATE PmrF pmr phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36593 " 196 UPDATE Mycobacterium tuberculosis embB mutant conferring resistance to ethambutol ethambutol resistant embB; polyamine antibiotic; antibiotic target alteration; model_name; model_param; ARO_name; ARO_category "UPDATED model_name with Mycobacterium tuberculosis embB with mutation conferring resistance to ethambutol UPDATED 15433 with M306V UPDATED 15450 with G406S UPDATED 15458 with Q497R UPDATED 9487 with Y319C DELETED 13342 UPDATED ARO_name with Mycobacterium tuberculosis embB with mutation conferring resistance to ethambutol DELETED 36636 " 366 UPDATE Mycobacterium tuberculosis iniA mutant conferring resistance to ethambutol ethambutol resistant iniA; polyamine antibiotic; antibiotic target alteration; antibiotic efflux; ARO_category "DELETED 36636 " 505 UPDATE Mycobacterium tuberculosis iniC mutant conferring resistance to ethambutol Ethambutol resistant iniC; polyamine antibiotic; antibiotic target alteration; antibiotic efflux; ARO_category "DELETED 36636 " 597 UPDATE Klebsiella pneumoniae ramR mutants resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; fluoroquinolone antibiotic; cephalosporin; glycylcycline; penicillin beta-lactam; tetracycline antibiotic; rifamycin antibiotic; phenicol antibiotic; disinfecting agents and antiseptics; antibiotic target alteration; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35949 " 627 UPDATE Escherichia coli rpoB mutants conferring resistance to rifampicin rifamycin-resistant beta-subunit of RNA polymerase (rpoB); rifamycin antibiotic; antibiotic target alteration; antibiotic target replacement; model_param; ARO_category "UPDATED param_type with single resistance variant UPDATED param_description with A sequence change where, compared to a reference sequence, one amino acid is replaced by one other amino acid that is associated with elevated resistance to antibiotic(s) relative to wild type. Format is given as [wild-type][position][mutation], e.g. R184Q or R447Var where Var represents any possible substitution. UPDATED param_type_id with 36301 UPDATED 9917 with T563P DELETED 36308 " 756 UPDATE Enterococcus faecium liaR mutant conferring daptomycin resistance daptomycin resistant liaR; antibiotic efflux regulatory protein; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35985 " 794 UPDATE Staphylococcus aureus rpoC conferring resistance to daptomycin daptomycin-resistant beta prime subunit of RNA polymerase (rpoC); peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35985 " 851 UPDATE Mycobacterium tuberculosis pncA mutations conferring resistance to pyrazinamide Pyrazinamide resistant pncA; pyrazine antibiotic; antibiotic target alteration; model_param; ARO_category "UPDATED param_type with deletion mutation from peptide sequence UPDATED param_description with A peptide sequence change between the translation initiation (start) and termination (stop) codon where, compared to a reference sequence, one or more amino acids are deleted and therefore are not present. These represent in-frame deletions which do not result in frameshift variants and may include multiple amino acids. Format is given by [wildtype AA][position]del for a single peptide deletion or [wildtype AA][position]_[wildtype AA][position]del for a deleted peptide range, e.g. K527del or Q517_N518del. UPDATED param_type_id with 41342 UPDATED 19173 with D63_S67del UPDATED 19160 with D126_V130del UPDATED 19162 with D129_V131del UPDATED 19180 with E127_D129del UPDATED 19142 with A178_S179del UPDATED 19227 with S104_G108del UPDATED 15104 with M175T UPDATED 15134 with V155G UPDATED 15158 with H137P UPDATED 15197 with L116R UPDATED 15211 with S104R UPDATED 15215 with Y103H UPDATED 15224 with G97R UPDATED 15226 with G97D UPDATED 15231 with K96R UPDATED 15239 with F94C UPDATED 15293 with S59P UPDATED 15364 with D12N UPDATED 15375 with D8H UPDATED 15380 with V7G UPDATED 15383 with V7L UPDATED 9650 with I5T UPDATED 9653 with H57D UPDATED 9658 with P62S UPDATED 9666 with T76P UPDATED 2618 with G132S UPDATED 4214 with V9G UPDATED 4307 with T47P UPDATED 9924 with E174G UPDATED 14082 with V155M UPDATED 3427 with P54T DELETED 13297 UPDATED 13855 with G55C UPDATED 13954 with F106Y UPDATED 13957 with G55C UPDATED 13854 with S59P UPDATED 14011 with I6M UPDATED 14021 with Q10H UPDATED 14035 with S179N UPDATED 14042 with T153N UPDATED 14057 with V128D UPDATED 14062 with V180D UPDATED 14066 with V44D UPDATED 14071 with V93L UPDATED 14086 with A170V UPDATED 14101 with A38G UPDATED 14104 with A38G UPDATED 14112 with A38G UPDATED 13975 with A38G UPDATED 14121 with A38G UPDATED 14154 with A79P UPDATED 14169 with D80H UPDATED 14094 with A38G UPDATED 14098 with A38G UPDATED 14100 with A38G UPDATED 14102 with A38G UPDATED 14103 with A38G UPDATED 14126 with A89V UPDATED 14129 with A46P UPDATED 14132 with C184R UPDATED 14170 with D8V UPDATED 14171 with D8V UPDATED 14173 with E127D UPDATED 14174 with D63E UPDATED 13415 with M1Var UPDATED 13460 with M1Var UPDATED 13808 with M1Var UPDATED 13850 with M1Var UPDATED 13932 with M1Var UPDATED 13933 with S59P UPDATED 13944 with M1Var UPDATED 13990 with M1Var UPDATED 13992 with M1Var UPDATED 13996 with M1Var UPDATED 14004 with M1Var UPDATED 14029 with M1Var UPDATED 14033 with M1Var UPDATED 14052 with M1Var UPDATED 14053 with S186F UPDATED 14054 with M1Var UPDATED 14175 with D63E UPDATED 13327 with Q141P UPDATED 14045 with Q10L UPDATED 13943 with T47S UPDATED 14000 with T47S UPDATED 14099 with T47S UPDATED 14115 with T47S UPDATED 19137 with T47P UPDATED 19138 with T47P UPDATED 19139 with T47P UPDATED 19141 with T47P UPDATED 19143 with T47P UPDATED 19145 with T47P UPDATED 19147 with T47P UPDATED 19149 with T47P UPDATED 19150 with T47P UPDATED 19192 with T47P UPDATED 19193 with T47P UPDATED 19235 with T47P UPDATED 19236 with T47P UPDATED 19237 with T47P UPDATED 19241 with T47P UPDATED 19242 with T47P UPDATED 19243 with T47P UPDATED 19244 with T47P UPDATED 19245 with T47P UPDATED 19246 with T47P UPDATED 19247 with T47P UPDATED 19248 with T47P UPDATED 19249 with T47P UPDATED 19250 with T47P UPDATED 19251 with T47P UPDATED 19252 with T47P UPDATED 19136 with E181K UPDATED 19151 with C138W UPDATED 19152 with C138W UPDATED 19153 with C138W UPDATED 19154 with C138W UPDATED 19155 with C138W UPDATED 19156 with C138W UPDATED 19157 with C138W UPDATED 19158 with C138W UPDATED 19161 with C138W UPDATED 19164 with C138W UPDATED 19165 with C138W UPDATED 19257 with C138W UPDATED 19258 with C138W UPDATED 19259 with C138W UPDATED 19260 with C138W UPDATED 19262 with C138W UPDATED 19208 with C138W UPDATED 19209 with C138W UPDATED 19210 with C138W UPDATED 19211 with C138W UPDATED 19213 with C138W UPDATED 19214 with C138W UPDATED 19216 with C138W UPDATED 19217 with C138W UPDATED 19218 with C138W UPDATED 19173 with C138W UPDATED 19160 with C138W UPDATED 19162 with C138W UPDATED 19180 with C138W UPDATED 19194 with C138W UPDATED 19196 with C138W UPDATED 19198 with C138W UPDATED 19199 with C138W UPDATED 19200 with C138W UPDATED 19201 with C138W UPDATED 19202 with C138W UPDATED 19203 with C138W UPDATED 19204 with C138W UPDATED 19206 with C138W UPDATED 19207 with C138W UPDATED 19169 with C138W UPDATED 19170 with C138W UPDATED 19171 with C138W UPDATED 19172 with C138W UPDATED 19174 with C138W UPDATED 19175 with C138W UPDATED 19176 with C138W UPDATED 19177 with C138W UPDATED 19178 with C138W UPDATED 19181 with C138W UPDATED 19182 with C138W UPDATED 19183 with C138W UPDATED 19184 with C138W UPDATED 19185 with C138W UPDATED 19188 with C138W UPDATED 19253 with C138W UPDATED 19254 with C138W UPDATED 19256 with C138W UPDATED 19167 with C138W UPDATED 19168 with C138W UPDATED 19142 with C138W UPDATED 19227 with C138W UPDATED 19144 with A3E UPDATED 19190 with A3E UPDATED 19238 with A3E UPDATED 19219 with A3E UPDATED 19220 with A3E UPDATED 19222 with A3E UPDATED 19223 with A3E UPDATED 19224 with A3E UPDATED 19226 with A3E UPDATED 19228 with A3E UPDATED 19230 with A3E UPDATED 19231 with A3E UPDATED 19232 with A3E UPDATED 15097 with L182W UPDATED 15108 with M1Var UPDATED 15109 with M1Var UPDATED 15120 with M1Var UPDATED 15143 with M1Var UPDATED 15150 with T142M UPDATED 15187 with M1Var UPDATED 15192 with M1Var UPDATED 15201 with M1Var UPDATED 15204 with M1Var UPDATED 15213 with M1Var UPDATED 15221 with A102P UPDATED 15223 with M1Var UPDATED 15236 with M1Var UPDATED 15244 with M1Var UPDATED 15273 with M1Var UPDATED 15277 with M1Var UPDATED 15279 with S66P UPDATED 15281 with M1Var UPDATED 15345 with M1Var UPDATED 15350 with M1Var UPDATED 15352 with M1Var UPDATED 15370 with D12E UPDATED 15329 with F13I UPDATED 15333 with F13I UPDATED 15398 with A3E UPDATED 15401 with A3E UPDATED 15402 with A3E UPDATED 3433 with M1Var UPDATED 3436 with M1Var UPDATED 4160 with M1Var UPDATED 4230 with M1Var UPDATED 4238 with M1Var UPDATED 4243 with M1Var UPDATED 4309 with M1Var UPDATED 9933 with M1Var UPDATED 4215 with C14Y UPDATED 4220 with A46E UPDATED 9938 with V9A UPDATED 4168 with Q10P UPDATED 9678 with Q10R UPDATED 9680 with A3E UPDATED 9683 with A3E UPDATED 9687 with T142M UPDATED 9676 with W68G UPDATED 9677 with Q10R UPDATED 9695 with L151S UPDATED 9702 with A3E UPDATED 19137 with A143fs UPDATED 19138 with A152fs UPDATED 19139 with A161fs UPDATED 19141 with A165fs UPDATED 19143 with A178fs UPDATED 19145 with A26fs UPDATED 19147 with A28fs UPDATED 19149 with A36fs UPDATED 19150 with A39fs UPDATED 19192 with G17fs UPDATED 19193 with G23fs UPDATED 19235 with S74fs UPDATED 19236 with S84fs UPDATED 19237 with T114fs UPDATED 19241 with T177fs UPDATED 19242 with T22fs UPDATED 19243 with T61fs UPDATED 19244 with T76fs UPDATED 19245 with T87fs UPDATED 19246 with W119fs UPDATED 19247 with Y103fs UPDATED 19248 with Y64fs UPDATED 19249 with Y95fs UPDATED 19250 with Y99fs UPDATED 19251 with V125fs UPDATED 19252 with V128fs UPDATED 19136 with A102fs UPDATED 19151 with A3fs UPDATED 19152 with A79fs UPDATED 19153 with A98fs UPDATED 19154 with R140fs UPDATED 19155 with R154fs UPDATED 19156 with R29fs UPDATED 19157 with N112fs UPDATED 19158 with N149fs UPDATED 19161 with D126fs UPDATED 19164 with D129fs UPDATED 19165 with D12fs UPDATED 19257 with V157fs UPDATED 19258 with V163fs UPDATED 19259 with V21fs UPDATED 19260 with V45fs UPDATED 19262 with V7fs UPDATED 19208 with L151fs UPDATED 19209 with L156fs UPDATED 19210 with L159fs UPDATED 19211 with L172fs UPDATED 19213 with L4fs UPDATED 19214 with L85fs UPDATED 19216 with K48fs UPDATED 19217 with K96fs UPDATED 19218 with M175fs UPDATED 19194 with G24fs UPDATED 19196 with G55fs UPDATED 19198 with G78fs UPDATED 19199 with G97fs UPDATED 19200 with H42fs UPDATED 19201 with H43fs UPDATED 19202 with H51fs UPDATED 19203 with H57fs UPDATED 19204 with I133fs UPDATED 19206 with I6fs UPDATED 19207 with L117fs UPDATED 19169 with D166fs UPDATED 19170 with D40fs UPDATED 19171 with D49fs UPDATED 19172 with D56fs UPDATED 19174 with D63fs UPDATED 19175 with D80fs UPDATED 19176 with D86fs UPDATED 19177 with D8fs UPDATED 19178 with Q122fs UPDATED 19181 with E144fs UPDATED 19182 with E15fs UPDATED 19183 with E173fs UPDATED 19184 with E181fs UPDATED 19185 with E37fs UPDATED 19188 with G132fs UPDATED 19253 with V130fs UPDATED 19254 with V131fs UPDATED 19256 with V155fs UPDATED 19167 with D136fs UPDATED 19168 with D158fs UPDATED 19144 with A20fs UPDATED 19190 with G150fs UPDATED 19238 with T153fs UPDATED 19219 with F106fs UPDATED 19220 with F13fs UPDATED 19222 with F81fs UPDATED 19223 with F94fs UPDATED 19224 with P115fs UPDATED 19226 with P83fs UPDATED 19228 with S164fs UPDATED 19230 with S18fs UPDATED 19231 with S32fs UPDATED 19232 with S65fs DELETED 39997 " 984 UPDATE Bartonella bacilliformis gyrA conferring resistance to fluoroquinolones fluoroquinolone resistant gyrA; fluoroquinolone antibiotic; nybomycin-like antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3007157 UPDATED category_aro_cvterm_id with 45739 UPDATED category_aro_name with nybomycin-like antibiotic UPDATED category_aro_description with A group of antibiotics including nybomycin and its derivatives. UPDATED category_aro_class_name with Drug Class DELETED 35942 " 1088 UPDATE Staphylococcus aureus rpoB mutants conferring resistance to daptomycin daptomycin-resistant beta-subunit of RNA polymerase (rpoB); peptide antibiotic; rifamycin antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35985 " 1108 UPDATE Enterococcus faecium liaS mutant conferring daptomycin resistance daptomycin resistant liaS; antibiotic efflux regulatory protein; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35985 " 1166 UPDATE Staphylococcus aureus gyrA conferring resistance to fluoroquinolones fluoroquinolone resistant gyrA; fluoroquinolone antibiotic; nybomycin-like antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3007157 UPDATED category_aro_cvterm_id with 45739 UPDATED category_aro_name with nybomycin-like antibiotic UPDATED category_aro_description with A group of antibiotics including nybomycin and its derivatives. UPDATED category_aro_class_name with Drug Class DELETED 35942 " 1175 UPDATE Enterococcus faecium cls conferring resistance to daptomycin daptomycin resistant cls; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35985 " 1996 UPDATE vanX gene in vanM cluster vanX; glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 1991 UPDATE otr(C) ATP-binding cassette (ABC) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 2020 UPDATE tet(O) tetracycline-resistant ribosomal protection protein; tetracycline antibiotic; antibiotic target protection; ARO_category "DELETED 35968 " 2037 UPDATE tet(T) tetracycline-resistant ribosomal protection protein; tetracycline antibiotic; antibiotic target protection; ARO_category "DELETED 35968 " 1176 UPDATE Mycobacterium tuberculosis katG mutations conferring resistance to isoniazid isoniazid resistant katG; isoniazid-like antibiotic; antibiotic target alteration; model_param; ARO_category "UPDATED param_type with frameshift mutation UPDATED param_description with A frameshift is a sequence change between the translation initiation (start) and termination (stop) codon where, compared to a reference sequence, translation shifts to another reading frame as caused by nucleotide insertions and deletions. In ARO, these are annotated at the protein level with the first changed most N-terminal wildtype amino acid position. Format is given as [wildtype AA][position]fs, e.g. S531fs where S531 is a frameshifted coordinate beginning with codon 531. Termination may also be denoted as: Ter[position]fs. UPDATED param_type_id with 40494 UPDATED 19090 with M26fs UPDATED 19091 with M624fs UPDATED 19092 with F272fs UPDATED 19095 with P325fs UPDATED 19096 with P422fs UPDATED 19099 with P569fs UPDATED 19100 with P622fs UPDATED 19101 with P642fs UPDATED 19102 with P6fs UPDATED 19103 with P7fs UPDATED 19104 with S302fs UPDATED 19107 with S652fs UPDATED 19108 with T203fs UPDATED 19111 with T394fs UPDATED 19113 with W351fs UPDATED 19114 with W39fs UPDATED 19115 with W505fs UPDATED 19116 with W668fs UPDATED 19117 with W689fs UPDATED 19018 with A478fs UPDATED 19021 with A551fs UPDATED 19022 with A559fs UPDATED 19024 with R496fs UPDATED 19026 with N18fs UPDATED 19027 with N236fs UPDATED 19028 with N35fs UPDATED 19029 with N51fs UPDATED 19030 with N535fs UPDATED 19031 with D163fs UPDATED 19033 with D329fs UPDATED 19034 with D381fs UPDATED 19036 with D513fs UPDATED 19037 with D56fs UPDATED 19038 with D656fs UPDATED 19039 with D695fs UPDATED 19043 with Q525fs UPDATED 19045 with E10fs UPDATED 19049 with E342fs UPDATED 19050 with E3fs UPDATED 19118 with Y197fs UPDATED 19119 with Y339fs UPDATED 19122 with Y95fs UPDATED 19124 with V166fs UPDATED 19127 with V30fs UPDATED 19128 with V319fs UPDATED 19129 with V386fs UPDATED 19130 with V431fs UPDATED 19131 with V445fs UPDATED 19132 with V517fs UPDATED 19133 with V538fs UPDATED 19051 with E582fs UPDATED 19054 with E651fs UPDATED 19055 with E669fs UPDATED 19053 with E648fs UPDATED 19106 with S650fs UPDATED 19105 with S539fs UPDATED 19135 with V83fs UPDATED 19041 with C20fs UPDATED 19040 with D729fs UPDATED 19047 with E208fs UPDATED 19059 with G124fs UPDATED 19060 with G212fs UPDATED 19061 with G268fs UPDATED 19062 with G279fs UPDATED 19063 with G34fs UPDATED 19064 with G358fs UPDATED 19065 with G369fs UPDATED 19066 with G601fs UPDATED 19067 with H25fs UPDATED 19068 with H400fs UPDATED 19069 with H561fs UPDATED 19070 with I335fs UPDATED 19071 with I393fs UPDATED 19072 with I455fs UPDATED 19073 with I536fs UPDATED 19074 with I563fs UPDATED 19015 with A16fs UPDATED 19016 with A202fs UPDATED 19052 with E623fs UPDATED 19023 with A585fs UPDATED 19032 with D240fs UPDATED 19044 with Q578fs UPDATED 19098 with P429fs UPDATED 19112 with W198fs UPDATED 19125 with V22fs UPDATED 19134 with V586fs UPDATED 19075 with I8fs UPDATED 19076 with L173fs UPDATED 19078 with L382fs UPDATED 19080 with L696fs UPDATED 19082 with K157fs UPDATED 19083 with K179fs UPDATED 19084 with K200fs UPDATED 19085 with K433fs UPDATED 19086 with K459fs UPDATED 19087 with K46fs UPDATED 19088 with K557fs UPDATED 19089 with K590fs UPDATED 14968 with S315I DELETED 13417 UPDATED 19090 with G593D UPDATED 19091 with G593D UPDATED 19092 with G593D UPDATED 19095 with G593D UPDATED 19096 with G593D UPDATED 19099 with G593D UPDATED 19100 with G593D UPDATED 19101 with G593D UPDATED 19102 with G593D UPDATED 19103 with G593D UPDATED 19104 with G593D UPDATED 19107 with G593D UPDATED 19108 with G593D UPDATED 19111 with G593D UPDATED 19113 with G593D UPDATED 19114 with G593D UPDATED 19115 with G593D UPDATED 19116 with G593D UPDATED 19117 with G593D UPDATED 19018 with G593D UPDATED 19021 with G593D UPDATED 19022 with G593D UPDATED 19024 with G593D UPDATED 19026 with G593D UPDATED 19027 with G593D UPDATED 19028 with G593D UPDATED 19029 with G593D UPDATED 19030 with G593D UPDATED 19031 with G593D UPDATED 19033 with G593D UPDATED 19034 with G593D UPDATED 19036 with G593D UPDATED 19037 with G593D UPDATED 19038 with G593D UPDATED 19039 with G593D UPDATED 19043 with G593D UPDATED 19045 with G593D UPDATED 19049 with G593D UPDATED 19050 with G593D UPDATED 19118 with G593D UPDATED 19119 with G593D UPDATED 19122 with G593D UPDATED 19124 with G593D UPDATED 19127 with G593D UPDATED 19128 with G593D UPDATED 19129 with G593D UPDATED 19130 with G593D UPDATED 19131 with G593D UPDATED 19132 with G593D UPDATED 19133 with G593D UPDATED 19051 with P365R UPDATED 19054 with P365R UPDATED 19055 with P365R UPDATED 19053 with P365R UPDATED 19106 with A109T UPDATED 19105 with A109T UPDATED 19135 with P232R UPDATED 19041 with H417Q UPDATED 19040 with H417Q UPDATED 19047 with H417Q UPDATED 19059 with N655D UPDATED 19060 with N655D UPDATED 19061 with N655D UPDATED 19062 with N655D UPDATED 19063 with N655D UPDATED 19064 with N655D UPDATED 19065 with N655D UPDATED 19066 with N655D UPDATED 19067 with N655D UPDATED 19068 with N655D UPDATED 19069 with N655D UPDATED 19070 with N655D UPDATED 19071 with N655D UPDATED 19072 with N655D UPDATED 19073 with N655D UPDATED 19074 with N655D UPDATED 19015 with S315I UPDATED 19016 with S315I UPDATED 19052 with S315I UPDATED 19023 with S315T UPDATED 19032 with S315T UPDATED 19044 with S315T UPDATED 19098 with S315T UPDATED 19112 with S315T UPDATED 19125 with S315T UPDATED 19134 with S315T UPDATED 19075 with S315T UPDATED 19076 with S315T UPDATED 19078 with S315T UPDATED 19080 with S315T UPDATED 19082 with S315T UPDATED 19083 with S315T UPDATED 19084 with S315T UPDATED 19085 with S315T UPDATED 19086 with S315T UPDATED 19087 with S315T UPDATED 19088 with S315T UPDATED 19089 with S315T UPDATED 14858 with S315I UPDATED 14872 with V1Var UPDATED 14873 with V1Var UPDATED 14874 with V1Var UPDATED 14885 with V1Var UPDATED 14889 with V1Var UPDATED 14903 with S315I UPDATED 14914 with V1Var UPDATED 14923 with V1Var UPDATED 14929 with V1Var UPDATED 14930 with V1Var UPDATED 14934 with V1Var UPDATED 14945 with S315I UPDATED 14946 with V1Var UPDATED 14962 with V1Var UPDATED 14977 with V1Var UPDATED 15008 with V1Var UPDATED 15009 with S315T UPDATED 15020 with V1Var UPDATED 15023 with V1Var UPDATED 15027 with V1Var UPDATED 15033 with V1Var UPDATED 15036 with V1Var UPDATED 15062 with S315T UPDATED 15068 with V1Var UPDATED 15082 with V1Var UPDATED 15083 with V1Var UPDATED 15086 with V1Var UPDATED 15087 with V1Var UPDATED 3763 with V1Var UPDATED 8241 with V1Var UPDATED 3694 with N655D UPDATED 10019 with S315T DELETED 36659 " 1197 UPDATE Mycobacterium tuberculosis rpsL mutations conferring resistance to Streptomycin antibiotic-resistant rpsL; aminoglycoside antibiotic; antibiotic target alteration; model_name; ARO_name; ARO_category "UPDATED model_name with Mycobacterium tuberculosis rpsL mutations conferring resistance to streptomycin UPDATED ARO_name with Mycobacterium tuberculosis rpsL mutations conferring resistance to streptomycin DELETED 35958 " 1301 UPDATE Staphylococcus aureus cls conferring resistance to daptomycin daptomycin resistant cls; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35985 " 1320 UPDATE Klebsiella mutant PhoP conferring antibiotic resistance to colistin ATP-binding cassette (ABC) antibiotic efflux pump; pmr phosphoethanolamine transferase; transmembrane protein conferring colistin resistance; antibiotic efflux regulatory protein; macrolide antibiotic; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; antibiotic efflux; resistance by absence; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35925 " 1339 UPDATE Mycobacterium tuberculosis embR mutant conferring resistance to ethambutol ethambutol resistant embR; polyamine antibiotic; antibiotic target alteration; ARO_category "DELETED 36636 " 1354 UPDATE Mycobacterium tuberculosis embA mutant conferring resistance to ethambutol ethambutol resistant embA; polyamine antibiotic; antibiotic target alteration; ARO_category "DELETED 36636 " 1360 UPDATE Bartonella bacilliformis gyrB conferring resistance to aminocoumarin aminocoumarin resistant gyrB; aminocoumarin antibiotic; antibiotic target alteration; ARO_category "DELETED 36250 " 1574 UPDATE Mycobacterium tuberculosis inhA mutations conferring resistance to isoniazid isoniazid resistant inhA; isoniazid-like antibiotic; antibiotic target alteration; ARO_category "DELETED 36659 " 1822 UPDATE Staphylococcus aureus gyrB conferring resistance to aminocoumarin aminocoumarin resistant gyrB; aminocoumarin antibiotic; antibiotic target alteration; ARO_category "DELETED 36250 " 1849 UPDATE Mycobacterium tuberculosis tlyA mutations conferring resistance to aminoglycosides antibiotic resistant tlyA; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with antibiotic resistant tlyA DELETED 35958 " 1935 UPDATE Mycobacterium tuberculosis gyrA conferring resistance to fluoroquinolones fluoroquinolone resistant gyrA; fluoroquinolone antibiotic; nybomycin-like antibiotic; antibiotic target alteration; model_param; ARO_category "UPDATED 9625 with D89N DELETED 14272 UPDATED 3843 with T80A UPDATED category_aro_accession with 3007157 UPDATED category_aro_cvterm_id with 45739 UPDATED category_aro_name with nybomycin-like antibiotic UPDATED category_aro_description with A group of antibiotics including nybomycin and its derivatives. UPDATED category_aro_class_name with Drug Class DELETED 35942 " 1943 UPDATE Mycobacterium tuberculosis kasA mutant conferring resistance to isoniazid antibiotic resistant kasA; isoniazid-like antibiotic; antibiotic target alteration; ARO_category "DELETED 36659 " 2068 UPDATE Escherichia coli 16S rRNA mutation conferring resistance to edeine 16s rRNA with mutation conferring resistance to peptide antibiotics; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36269 " 2070 UPDATE Mycobacterium tuberculosis 16S rRNA mutation conferring resistance to amikacin 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35932 " 2076 UPDATE Neisseria gonorrhoeae 16S rRNA mutation conferring resistance to spectinomycin 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35957 " 2137 UPDATE Escherichia coli EF-Tu mutants conferring resistance to kirromycin elfamycin resistant EF-Tu; elfamycin antibiotic; antibiotic target alteration; ARO_category "DELETED 37633 " 2158 UPDATE Escherichia coli EF-Tu mutants conferring resistance to Pulvomycin elfamycin resistant EF-Tu; elfamycin antibiotic; antibiotic target alteration; ARO_category "DELETED 36725 " 2078 UPDATE Mycobacteroides chelonae 16S rRNA mutation conferring resistance to kanamycin A 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35966 " 2124 UPDATE Clostridioides difficile EF-Tu mutants conferring resistance to elfamycin elfamycin resistant EF-Tu; elfamycin antibiotic; antibiotic target alteration; ARO_category "DELETED 39998 " 1545 UPDATE Escherichia coli gyrA conferring resistance to fluoroquinolones fluoroquinolone resistant gyrA; fluoroquinolone antibiotic; nybomycin-like antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3007157 UPDATED category_aro_cvterm_id with 45739 UPDATED category_aro_name with nybomycin-like antibiotic UPDATED category_aro_description with A group of antibiotics including nybomycin and its derivatives. UPDATED category_aro_class_name with Drug Class DELETED 35942 " 1005 UPDATE Escherichia coli soxR with mutation conferring antibiotic resistance ATP-binding cassette (ABC) antibiotic efflux pump; major facilitator superfamily (MFS) antibiotic efflux pump; resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; fluoroquinolone antibiotic; cephalosporin; glycylcycline; penicillin beta-lactam; tetracycline antibiotic; rifamycin antibiotic; phenicol antibiotic; disinfecting agents and antiseptics; antibiotic target alteration; antibiotic efflux; model_param; ARO_category "UPDATED 7541 with R90G UPDATED 12870 with R90G UPDATED 18555 with R90G UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35949 " 1055 UPDATE Escherichia coli parE conferring resistance to fluoroquinolones fluoroquinolone resistant parE; fluoroquinolone antibiotic; antibiotic target alteration; ARO_category "DELETED 35942 " 2066 UPDATE Escherichia coli soxS with mutation conferring antibiotic resistance ATP-binding cassette (ABC) antibiotic efflux pump; major facilitator superfamily (MFS) antibiotic efflux pump; resistance-nodulation-cell division (RND) antibiotic efflux pump; General Bacterial Porin with reduced permeability to beta-lactams; antibiotic efflux regulatory protein; fluoroquinolone antibiotic; monobactam; carbapenem; cephalosporin; glycylcycline; penicillin beta-lactam; tetracycline antibiotic; rifamycin antibiotic; phenicol antibiotic; disinfecting agents and antiseptics; antibiotic target alteration; antibiotic efflux; reduced permeability to antibiotic; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35949 " 1989 UPDATE Klebsiella pneumoniae acrR with mutation conferring multidrug antibiotic resistance resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; fluoroquinolone antibiotic; cephalosporin; glycylcycline; penicillin beta-lactam; tetracycline antibiotic; rifamycin antibiotic; phenicol antibiotic; disinfecting agents and antiseptics; antibiotic target alteration; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35949 " 1721 UPDATE Mycobacterium leprae folP with mutation conferring resistance to dapsone dapsone resistant dihydropteroate synthase folP; sulfone antibiotic; antibiotic target alteration; ARO_category "DELETED 39996 " 100 UPDATE Mycobacterium tuberculosis ethA with mutation conferring resistance to ethionamide ethionamide resistant ethA; thioamide antibiotic; antibiotic target alteration; model_param; ARO_category "UPDATED 9505 with N379D DELETED 15526 UPDATED 18904 with T186K UPDATED 18905 with T186K UPDATED 18906 with T186K UPDATED 18907 with T186K UPDATED 18909 with T186K UPDATED 18910 with T186K UPDATED 18788 with T186K UPDATED 18787 with T186K UPDATED 18785 with Y84D UPDATED 18886 with Y84D UPDATED 18887 with Y84D UPDATED 18889 with Y84D UPDATED 18885 with Y84D UPDATED 18789 with E223K UPDATED 18790 with E223K UPDATED 18792 with E223K UPDATED 18793 with E223K UPDATED 18794 with E223K UPDATED 18795 with E223K UPDATED 18796 with E223K UPDATED 18797 with E223K UPDATED 18798 with E223K UPDATED 18799 with E223K UPDATED 18800 with E223K UPDATED 18801 with E223K UPDATED 18802 with E223K UPDATED 18803 with E223K UPDATED 18804 with E223K UPDATED 18806 with E223K UPDATED 18807 with E223K UPDATED 18808 with E223K UPDATED 18809 with E223K UPDATED 18810 with E223K UPDATED 18811 with E223K UPDATED 18812 with E223K UPDATED 18846 with E223K UPDATED 18847 with E223K UPDATED 18848 with E223K UPDATED 18849 with E223K UPDATED 18850 with E223K UPDATED 18852 with E223K UPDATED 18853 with E223K UPDATED 18855 with E223K UPDATED 18856 with E223K UPDATED 18857 with E223K UPDATED 18921 with E223K UPDATED 18922 with E223K UPDATED 18924 with E223K UPDATED 18925 with E223K UPDATED 18926 with E223K UPDATED 18927 with E223K UPDATED 18928 with E223K UPDATED 18929 with E223K UPDATED 18930 with E223K UPDATED 18931 with E223K UPDATED 18933 with E223K UPDATED 18934 with E223K UPDATED 18935 with E223K UPDATED 18937 with E223K UPDATED 18938 with E223K UPDATED 18986 with E223K UPDATED 18987 with E223K UPDATED 18833 with E223K UPDATED 18834 with E223K UPDATED 18835 with E223K UPDATED 18836 with E223K UPDATED 18867 with E223K UPDATED 18869 with E223K UPDATED 18870 with E223K UPDATED 18871 with E223K UPDATED 18872 with E223K UPDATED 18873 with E223K UPDATED 18874 with E223K UPDATED 18875 with E223K UPDATED 18939 with E223K UPDATED 18940 with E223K UPDATED 18942 with E223K UPDATED 18943 with E223K UPDATED 18945 with E223K UPDATED 18946 with E223K UPDATED 18947 with E223K UPDATED 18948 with E223K UPDATED 18949 with E223K UPDATED 18858 with E223K UPDATED 18859 with E223K UPDATED 18860 with E223K UPDATED 18861 with E223K UPDATED 18862 with E223K UPDATED 18863 with E223K UPDATED 18864 with E223K UPDATED 18865 with E223K UPDATED 18866 with E223K UPDATED 18775 with R463S UPDATED 18776 with R463S UPDATED 18950 with R463S UPDATED 18951 with R463S UPDATED 18953 with R463S UPDATED 18954 with R463S UPDATED 18956 with R463S UPDATED 18957 with R463S UPDATED 18958 with R463S UPDATED 18959 with R463S UPDATED 18960 with R463S UPDATED 18962 with R463S UPDATED 18963 with R463S UPDATED 18964 with R463S UPDATED 18965 with R463S UPDATED 18966 with R463S UPDATED 18968 with R463S UPDATED 18969 with R463S UPDATED 18971 with R463S UPDATED 18972 with R463S UPDATED 18974 with R463S UPDATED 18975 with R463S UPDATED 18976 with R463S UPDATED 18978 with R463S UPDATED 18979 with R463S UPDATED 18981 with R463S UPDATED 18982 with R463S UPDATED 18984 with R463S UPDATED 18985 with R463S UPDATED 18777 with R463S UPDATED 18779 with R463S UPDATED 18782 with R463S UPDATED 18783 with R463S UPDATED 18992 with R463S UPDATED 18993 with R463S UPDATED 18994 with R463S UPDATED 18996 with R463S UPDATED 18997 with R463S UPDATED 18998 with R463S UPDATED 18999 with R463S UPDATED 19000 with R463S UPDATED 19001 with R463S UPDATED 19002 with R463S UPDATED 19003 with R463S UPDATED 19005 with R463S UPDATED 19006 with R463S UPDATED 19007 with R463S UPDATED 19008 with R463S UPDATED 19009 with R463S UPDATED 19010 with R463S UPDATED 19012 with R463S UPDATED 19014 with R463S UPDATED 18838 with R463S UPDATED 18839 with R463S UPDATED 18840 with R463S UPDATED 18842 with R463S UPDATED 18843 with R463S UPDATED 18844 with R463S UPDATED 18845 with R463S UPDATED 18876 with R463S UPDATED 18877 with R463S UPDATED 18878 with R463S UPDATED 18879 with R463S UPDATED 18819 with R463S UPDATED 18821 with R463S UPDATED 18822 with R463S UPDATED 18823 with R463S UPDATED 18824 with R463S UPDATED 18825 with R463S UPDATED 18826 with R463S UPDATED 18827 with R463S UPDATED 18829 with R463S UPDATED 18830 with R463S UPDATED 18831 with R463S UPDATED 18832 with R463S UPDATED 18818 with R463S UPDATED 18820 with N379D UPDATED 18828 with N379D UPDATED 18911 with N379D UPDATED 18952 with N379D UPDATED 18961 with N379D UPDATED 18970 with N379D UPDATED 18980 with N379D UPDATED 18884 with N379D UPDATED 18913 with N379D UPDATED 18914 with N379D UPDATED 18916 with N379D UPDATED 18917 with N379D UPDATED 18918 with N379D UPDATED 18919 with N379D UPDATED 18890 with N379D UPDATED 18892 with N379D UPDATED 18893 with N379D UPDATED 18894 with N379D UPDATED 18895 with N379D UPDATED 18896 with N379D UPDATED 18898 with N379D UPDATED 18899 with N379D UPDATED 18815 with N379D UPDATED 18816 with N379D UPDATED 18882 with N379D UPDATED 18900 with N379D UPDATED 18901 with N379D UPDATED 18902 with N379D UPDATED 18903 with N379D UPDATED 18988 with N379D UPDATED 18989 with N379D UPDATED 18990 with N379D UPDATED 18991 with N379D UPDATED 18813 with N379D UPDATED 18814 with N379D UPDATED 15482 with R463S UPDATED 15499 with R463S UPDATED 15522 with R463S UPDATED 15554 with N379D UPDATED 15566 with N379D UPDATED 15594 with A341V UPDATED 15599 with A341V UPDATED 15602 with A341V UPDATED 15603 with A341V UPDATED 15608 with N379D UPDATED 15613 with R207G UPDATED 15618 with V202G UPDATED 15639 with N379D UPDATED 15640 with V202G UPDATED 15743 with N379D UPDATED 9506 with N379D UPDATED 9508 with E223K UPDATED 8312 with T186K UPDATED 18904 with L47fs UPDATED 18905 with L82fs UPDATED 18906 with K103fs UPDATED 18907 with K200fs UPDATED 18909 with K224fs UPDATED 18910 with K241fs UPDATED 18788 with A354fs UPDATED 18787 with A352fs UPDATED 18785 with A248fs UPDATED 18886 with I9fs UPDATED 18887 with L126fs UPDATED 18889 with L129fs UPDATED 18885 with I94fs UPDATED 18789 with A395fs UPDATED 18790 with A90fs UPDATED 18792 with R207fs UPDATED 18793 with R258fs UPDATED 18794 with R259fs UPDATED 18795 with R421fs UPDATED 18796 with R452fs UPDATED 18797 with R463fs UPDATED 18798 with R466fs UPDATED 18799 with R470fs UPDATED 18800 with R479fs UPDATED 18801 with R54fs UPDATED 18802 with N114fs UPDATED 18803 with N226fs UPDATED 18804 with N242fs UPDATED 18806 with N287fs UPDATED 18807 with N298fs UPDATED 18808 with N345fs UPDATED 18809 with N379fs UPDATED 18810 with N388fs UPDATED 18811 with N458fs UPDATED 18812 with D170fs UPDATED 18846 with E400fs UPDATED 18847 with E428fs UPDATED 18848 with E445fs UPDATED 18849 with E83fs UPDATED 18850 with G11fs UPDATED 18852 with G275fs UPDATED 18853 with G283fs UPDATED 18855 with G299fs UPDATED 18856 with G350fs UPDATED 18857 with G371fs UPDATED 18921 with M233fs UPDATED 18922 with M260fs UPDATED 18924 with M372fs UPDATED 18925 with M432fs UPDATED 18926 with M59fs UPDATED 18927 with F100fs UPDATED 18928 with F151fs UPDATED 18929 with F282fs UPDATED 18930 with F349fs UPDATED 18931 with F414fs UPDATED 18933 with F431fs UPDATED 18934 with F434fs UPDATED 18935 with F64fs UPDATED 18937 with P160fs UPDATED 18938 with P209fs UPDATED 18986 with W228fs UPDATED 18987 with W256fs UPDATED 18833 with Q269fs UPDATED 18834 with Q271fs UPDATED 18835 with Q73fs UPDATED 18836 with E169fs UPDATED 18867 with H163fs UPDATED 18869 with H22fs UPDATED 18870 with H281fs UPDATED 18871 with H285fs UPDATED 18872 with H4fs UPDATED 18873 with H97fs UPDATED 18874 with I161fs UPDATED 18875 with I178fs UPDATED 18939 with P230fs UPDATED 18940 with P257fs UPDATED 18942 with P284fs UPDATED 18943 with P28fs UPDATED 18945 with P422fs UPDATED 18946 with P436fs UPDATED 18947 with P68fs UPDATED 18948 with S106fs UPDATED 18949 with S122fs UPDATED 18858 with G385fs UPDATED 18859 with G423fs UPDATED 18860 with G42fs UPDATED 18861 with G437fs UPDATED 18862 with G43fs UPDATED 18863 with G477fs UPDATED 18864 with G93fs UPDATED 18865 with H101fs UPDATED 18866 with H119fs UPDATED 18775 with A128fs UPDATED 18776 with A185fs UPDATED 18950 with S138fs UPDATED 18951 with S148fs UPDATED 18953 with S208fs UPDATED 18954 with S214fs UPDATED 18956 with S251fs UPDATED 18957 with S266fs UPDATED 18958 with S31fs UPDATED 18959 with S375fs UPDATED 18960 with S390fs UPDATED 18962 with S442fs UPDATED 18963 with S451fs UPDATED 18964 with T125fs UPDATED 18965 with T130fs UPDATED 18966 with T186fs UPDATED 18968 with T210fs UPDATED 18969 with T232fs UPDATED 18971 with T314fs UPDATED 18972 with T316fs UPDATED 18974 with T353fs UPDATED 18975 with T355fs UPDATED 18976 with T364fs UPDATED 18978 with T387fs UPDATED 18979 with T416fs UPDATED 18981 with T61fs UPDATED 18982 with T88fs UPDATED 18984 with W167fs UPDATED 18985 with W21fs UPDATED 18777 with A187fs UPDATED 18779 with A20fs UPDATED 18782 with A237fs UPDATED 18783 with A247fs UPDATED 18992 with Y211fs UPDATED 18993 with Y235fs UPDATED 18994 with Y276fs UPDATED 18996 with Y32fs UPDATED 18997 with Y369fs UPDATED 18998 with Y386fs UPDATED 18999 with Y60fs UPDATED 19000 with V104fs UPDATED 19001 with V118fs UPDATED 19002 with V158fs UPDATED 19003 with V179fs UPDATED 19005 with V191fs UPDATED 19006 with V238fs UPDATED 19007 with V249fs UPDATED 19008 with V296fs UPDATED 19009 with V313fs UPDATED 19010 with V384fs UPDATED 19012 with V489fs UPDATED 19014 with V85fs UPDATED 18838 with E223fs UPDATED 18839 with E274fs UPDATED 18840 with E311fs UPDATED 18842 with E318fs UPDATED 18843 with E36fs UPDATED 18844 with E39fs UPDATED 18845 with E3fs UPDATED 18876 with I181fs UPDATED 18877 with I221fs UPDATED 18878 with I325fs UPDATED 18879 with I337fs UPDATED 18819 with D396fs UPDATED 18821 with D415fs UPDATED 18822 with D464fs UPDATED 18823 with D46fs UPDATED 18824 with D77fs UPDATED 18825 with D95fs UPDATED 18826 with C131fs UPDATED 18827 with C253fs UPDATED 18829 with C294fs UPDATED 18830 with Q121fs UPDATED 18831 with Q165fs UPDATED 18832 with Q246fs UPDATED 18818 with D362fs UPDATED 18820 with D410fs UPDATED 18828 with C27fs UPDATED 18911 with K280fs UPDATED 18952 with S18fs UPDATED 18961 with S424fs UPDATED 18970 with T236fs UPDATED 18980 with T44fs UPDATED 18884 with I81fs UPDATED 18913 with K309fs UPDATED 18914 with K30fs UPDATED 18916 with K370fs UPDATED 18917 with K37fs UPDATED 18918 with K448fs UPDATED 18919 with K482fs UPDATED 18890 with L190fs UPDATED 18892 with L194fs UPDATED 18893 with L225fs UPDATED 18894 with L265fs UPDATED 18895 with L295fs UPDATED 18896 with L327fs UPDATED 18898 with L344fs UPDATED 18899 with L393fs UPDATED 18815 with D290fs UPDATED 18816 with D315fs UPDATED 18882 with I339fs UPDATED 18900 with L405fs UPDATED 18901 with L406fs UPDATED 18902 with L440fs UPDATED 18903 with L478fs UPDATED 18988 with W289fs UPDATED 18989 with W45fs UPDATED 18990 with W69fs UPDATED 18991 with Y147fs UPDATED 18813 with D196fs UPDATED 18814 with D219fs DELETED 40067 " 1323 UPDATE Salmonella serovars parE conferring resistance to fluoroquinolones fluoroquinolone resistant parE; fluoroquinolone antibiotic; antibiotic target alteration; ARO_category "DELETED 35942 " 1671 UPDATE Salmonella serovars soxS with mutation conferring antibiotic resistance ATP-binding cassette (ABC) antibiotic efflux pump; major facilitator superfamily (MFS) antibiotic efflux pump; resistance-nodulation-cell division (RND) antibiotic efflux pump; General Bacterial Porin with reduced permeability to beta-lactams; antibiotic efflux regulatory protein; fluoroquinolone antibiotic; monobactam; carbapenem; cephalosporin; glycylcycline; penicillin beta-lactam; tetracycline antibiotic; rifamycin antibiotic; phenicol antibiotic; disinfecting agents and antiseptics; antibiotic target alteration; antibiotic efflux; reduced permeability to antibiotic; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35949 " 953 UPDATE Enterococcus faecalis liaF mutant conferring daptomycin resistance daptomycin resistant liaF; antibiotic efflux regulatory protein; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35985 " 1135 UPDATE Staphylococcus aureus parE conferring resistance to aminocoumarin aminocoumarin resistant parE; aminocoumarin antibiotic; antibiotic target alteration; ARO_category "DELETED 36250 " 570 UPDATE Streptococcus pyogenes folP with mutation conferring resistance to sulfonamides sulfonamide resistant dihydropteroate synthase folP; sulfonamide antibiotic; antibiotic target alteration; ARO_category "DELETED 36463 " 2116 UPDATE Pasteurella multocida 16S rRNA mutation conferring resistance to spectinomycin 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35957 " 2147 UPDATE Escherichia coli EF-Tu mutants conferring resistance to Enacyloxin IIa elfamycin resistant EF-Tu; elfamycin antibiotic; antibiotic target alteration; ARO_category "DELETED 37641 " 2131 UPDATE Mycobacterium tuberculosis 16S rRNA mutation conferring resistance to streptomycin 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; model_param; ARO_category "UPDATED 9849 with c517t DELETED 13288 DELETED 35958 " 3301 UPDATE LnuP lincosamide nucleotidyltransferase (LNU); lincosamide antibiotic; antibiotic inactivation; ARO_category "DELETED 35964 " 1558 UPDATE Bacillus subtilis mprF defensin resistant mprF; peptide antibiotic; antibiotic target alteration; ARO_category "DELETED 37037 " 821 UPDATE Mycobacterium tuberculosis embB with mutation conferring resistance to rifampicin rifamycin-resistant arabinosyltransferase; rifamycin antibiotic; antibiotic target alteration; ARO_category "DELETED 36308 " 1001 UPDATE Staphylococcus aureus mprF with mutation conferring resistance to daptomycin daptomycin resistant mprF; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35985 " 1203 UPDATE Mycobacterium tuberculosis ndh with mutation conferring resistance to isoniazid antibiotic resistant ndh; isoniazid-like antibiotic; antibiotic target alteration; ARO_category "DELETED 36659 " 1395 UPDATE Neisseria gonorrhoeae porin PIB (por) General Bacterial Porin with reduced permeability to beta-lactams; monobactam; carbapenem; cephalosporin; penicillin beta-lactam; tetracycline antibiotic; reduced permeability to antibiotic; ARO_category "DELETED 35968 " 1432 UPDATE Mycobacterium tuberculosis embC mutant conferring resistance to ethambutol ethambutol resistant embC; polyamine antibiotic; antibiotic target alteration; model_param; ARO_category "UPDATED 4128 with N394D UPDATED 4130 with N394D UPDATED 4135 with N394D UPDATED 4138 with N394D UPDATED 4139 with N394D DELETED 36636 " 1710 UPDATE Mycobacterium leprae gyrB conferring resistance to fluoroquinolones fluoroquinolone resistant gyrB; fluoroquinolone antibiotic; antibiotic target alteration; ARO_category "DELETED 35942 " 2069 UPDATE Escherichia coli 16S rRNA (rrsB) mutation conferring resistance to neomycin 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35924 " 2073 UPDATE Escherichia coli 16S rRNA (rrsB) mutation conferring resistance to G418 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 36997 " 2074 UPDATE Salmonella enterica 16S rRNA (rrsD) mutation conferring resistance to spectinomycin 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35957 " 2109 UPDATE Mycobacterium tuberculosis gyrB mutant conferring resistance to fluoroquinolones fluoroquinolone resistant gyrB; fluoroquinolone antibiotic; antibiotic target alteration; model_name; model_param; ARO_name; ARO_category "UPDATED model_name with Mycobacterium tuberculosis gyrB with mutation conferring resistance to fluoroquinolones UPDATED 9630 with N499T DELETED 14245 UPDATED 3506 with E501V UPDATED 3512 with E501V UPDATED ARO_name with Mycobacterium tuberculosis gyrB with mutation conferring resistance to fluoroquinolones DELETED 35942 " 2077 UPDATE Mycolicibacterium smegmatis 16S rRNA (rrsA) mutation conferring resistance to neomycin 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35924 " 212 UPDATE Staphylococcus aureus parC conferring resistance to fluoroquinolones fluoroquinolone resistant parC; fluoroquinolone antibiotic; antibiotic target alteration; ARO_category "DELETED 35942 " 535 UPDATE Morganella morganii gyrB conferring resistance to fluoroquinolones fluoroquinolone resistant gyrB; fluoroquinolone antibiotic; antibiotic target alteration; ARO_category "DELETED 35942 " 36 UPDATE Mycobacterium leprae gyrA conferring resistance to fluoroquinolones fluoroquinolone resistant gyrA; fluoroquinolone antibiotic; nybomycin-like antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3007157 UPDATED category_aro_cvterm_id with 45739 UPDATED category_aro_name with nybomycin-like antibiotic UPDATED category_aro_description with A group of antibiotics including nybomycin and its derivatives. UPDATED category_aro_class_name with Drug Class DELETED 35942 " 1696 UPDATE Salmonella serovars gyrB conferring resistance to fluoroquinolones fluoroquinolone resistant gyrB; fluoroquinolone antibiotic; antibiotic target alteration; ARO_category "DELETED 35942 " 1441 UPDATE Klebsiella aerogenes Omp36 General Bacterial Porin with reduced permeability to beta-lactams; monobactam; carbapenem; cephalosporin; penicillin beta-lactam; reduced permeability to antibiotic; ARO_category "DELETED 35976 " 2085 UPDATE Escherichia coli 16S rRNA (rrnB) mutation conferring resistance to spectinomycin 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35957 " 2097 UPDATE Escherichia coli 16S rRNA (rrsB) mutation conferring resistance to paromomycin 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 37001 " 2113 UPDATE Escherichia coli 16S rRNA (rrsB) mutation conferring resistance to tobramycin 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35969 " 2129 UPDATE Escherichia coli 16S rRNA (rrsB) mutation conferring resistance to spectinomycin 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35957 " 1894 UPDATE Salmonella enterica ramR mutants resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; fluoroquinolone antibiotic; cephalosporin; glycylcycline; penicillin beta-lactam; tetracycline antibiotic; rifamycin antibiotic; phenicol antibiotic; disinfecting agents and antiseptics; antibiotic target alteration; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35949 " 2133 UPDATE Mycobacterium tuberculosis 16S rRNA mutation conferring resistance to viomycin 16s rRNA with mutation conferring resistance to peptide antibiotics; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35937 " 2152 UPDATE Neisseria meningitidis 16S rRNA mutation conferring resistance to spectinomycin 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35957 " 2176 UPDATE glycopeptide resistance gene cluster VanN glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 2177 UPDATE glycopeptide resistance gene cluster VanA glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 2178 UPDATE glycopeptide resistance gene cluster VanO glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 2179 UPDATE glycopeptide resistance gene cluster VanE glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 2180 UPDATE glycopeptide resistance gene cluster VanL glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 2181 UPDATE glycopeptide resistance gene cluster VanF glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 2182 UPDATE glycopeptide resistance gene cluster VanD glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 2183 UPDATE glycopeptide resistance gene cluster VanB glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 2184 UPDATE glycopeptide resistance gene cluster VanC glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 2185 UPDATE glycopeptide resistance gene cluster VanM glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 2186 UPDATE glycopeptide resistance gene cluster VanG glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 2192 UPDATE TriA resistance-nodulation-cell division (RND) antibiotic efflux pump; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 37250 " 2193 UPDATE TriB resistance-nodulation-cell division (RND) antibiotic efflux pump; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 37250 " 2194 UPDATE TriC resistance-nodulation-cell division (RND) antibiotic efflux pump; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 37250 " 2195 UPDATE OpmH resistance-nodulation-cell division (RND) antibiotic efflux pump; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 37250 " 3542 UPDATE OXA-480 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2196 UPDATE Pseudomonas aeruginosa gyrA conferring resistance to fluoroquinolones fluoroquinolone resistant gyrA; fluoroquinolone antibiotic; nybomycin-like antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3007157 UPDATED category_aro_cvterm_id with 45739 UPDATED category_aro_name with nybomycin-like antibiotic UPDATED category_aro_description with A group of antibiotics including nybomycin and its derivatives. UPDATED category_aro_class_name with Drug Class DELETED 35954 " 2211 UPDATE mexP resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; carbapenem; tetracycline antibiotic; diaminopyrimidine antibiotic; phenicol antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 35925 " 2212 UPDATE mexQ resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; carbapenem; tetracycline antibiotic; diaminopyrimidine antibiotic; phenicol antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 35925 " 2075 UPDATE Salmonella enterica soxR with mutation conferring antibiotic resistance ATP-binding cassette (ABC) antibiotic efflux pump; major facilitator superfamily (MFS) antibiotic efflux pump; resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; fluoroquinolone antibiotic; cephalosporin; glycylcycline; penicillin beta-lactam; tetracycline antibiotic; rifamycin antibiotic; phenicol antibiotic; disinfecting agents and antiseptics; antibiotic target alteration; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35949 " 2093 UPDATE Chlamydophila psittaci 16S rRNA mutation conferring resistance to spectinomycin 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35957 " 2143 UPDATE Borreliella burgdorferi 16S rRNA mutation conferring resistance to gentamicin 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35933 " 2132 UPDATE Mycobacterium tuberculosis 16S rRNA mutation conferring resistance to kanamycin 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35966 " 2127 UPDATE Borreliella burgdorferi 16S rRNA mutation conferring resistance to kanamycin 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35966 " 2154 UPDATE Borreliella burgdorferi 16S rRNA mutation conferring resistance to spectinomycin 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35957 " 2122 UPDATE Mycobacteroides chelonae 16S rRNA mutation conferring resistance to neomycin 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35924 " 2128 UPDATE Mycobacteroides abscessus 16S rRNA mutation conferring resistance to gentamicin 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35933 " 2111 UPDATE Mycobacteroides chelonae 16S rRNA mutation conferring resistance to tobramycin 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35969 " 2084 UPDATE Mycobacteroides abscessus 16S rRNA mutation conferring resistance to amikacin 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35932 " 2105 UPDATE Mycobacteroides abscessus 16S rRNA mutation conferring resistance to neomycin 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35924 " 2155 UPDATE Cutibacterium acnes 16S rRNA mutation conferring resistance to tetracycline 16S rRNA with mutation conferring resistance to tetracycline derivatives; tetracycline antibiotic; antibiotic target alteration; ARO_category "DELETED 35968 " 2100 UPDATE Mycobacteroides chelonae 16S rRNA mutation conferring resistance to amikacin 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35932 " 2091 UPDATE Mycobacteroides chelonae 16S rRNA mutation conferring resistance to gentamicin C 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35933 " 2090 UPDATE Mycobacteroides abscessus 16S rRNA mutation conferring resistance to kanamycin 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35966 " 2126 UPDATE Mycobacteroides abscessus 16S rRNA mutation conferring resistance to tobramycin 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35969 " 2198 UPDATE Pseudomonas aeruginosa parE conferring resistance to fluoroquinolones fluoroquinolone resistant parE; fluoroquinolone antibiotic; antibiotic target alteration; ARO_category "DELETED 35954 " 2136 UPDATE Escherichia coli 16S rRNA (rrsB) mutation conferring resistance to kanamycin A 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35966 " 2140 UPDATE Escherichia coli 16S rRNA (rrsB) mutation conferring resistance to streptomycin 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35958 " 2146 UPDATE Escherichia coli 16S rRNA (rrnB) mutation conferring resistance to streptomycin 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35958 " 2157 UPDATE Escherichia coli 16S rRNA (rrsB) mutation conferring resistance to gentamicin C 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35933 " 1450 UPDATE Escherichia coli parC conferring resistance to fluoroquinolones fluoroquinolone resistant parC; fluoroquinolone antibiotic; antibiotic target alteration; ARO_category "DELETED 35942 " 2083 UPDATE Mycoplasma hominis parC conferring resistance to fluoroquinolones fluoroquinolone resistant parC; fluoroquinolone antibiotic; antibiotic target alteration; ARO_category "DELETED 35942 " 2096 UPDATE Escherichia coli 16S rRNA (rrsC) mutation conferring resistance to kasugamicin 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 37695 " 2145 UPDATE Escherichia coli 16S rRNA (rrsB) mutation conferring resistance to tetracycline 16S rRNA with mutation conferring resistance to tetracycline derivatives; tetracycline antibiotic; antibiotic target alteration; ARO_category "DELETED 35968 " 2102 UPDATE Mycolicibacterium smegmatis 16S rRNA (rrsB) mutation conferring resistance to hygromycin B 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 36353 " 2149 UPDATE Mycolicibacterium smegmatis 16S rRNA (rrsA) mutation conferring resistance to hygromycin B 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 36353 " 2106 UPDATE Mycolicibacterium smegmatis 16S rRNA (rrsA) mutation conferring resistance to kanamycin A 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35966 " 2088 UPDATE Mycolicibacterium smegmatis 16S rRNA (rrsB) mutation conferring resistance to streptomycin 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35958 " 2141 UPDATE Mycolicibacterium smegmatis 16S rRNA (rrsB) mutation conferring resistance to neomycin 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35924 " 2099 UPDATE Mycolicibacterium smegmatis 16S rRNA (rrsB) mutation conferring resistance to kanamycin A 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35966 " 2142 UPDATE Mycolicibacterium smegmatis 16S rRNA (rrsA) mutation conferring resistance to viomycin 16s rRNA with mutation conferring resistance to peptide antibiotics; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35937 " 2205 UPDATE MexJ resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; tetracycline antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3005386 UPDATED category_aro_cvterm_id with 43746 UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. UPDATED category_aro_class_name with Drug Class DELETED 35925 " 2206 UPDATE MexK resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; tetracycline antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3005386 UPDATED category_aro_cvterm_id with 43746 UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. UPDATED category_aro_class_name with Drug Class DELETED 35925 " 2207 UPDATE MexV resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; fluoroquinolone antibiotic; tetracycline antibiotic; phenicol antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 35925 " 2208 UPDATE MexW resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; fluoroquinolone antibiotic; tetracycline antibiotic; phenicol antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 35925 " 2213 UPDATE opmE resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; carbapenem; tetracycline antibiotic; diaminopyrimidine antibiotic; phenicol antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 35925 " 2216 UPDATE mexM resistance-nodulation-cell division (RND) antibiotic efflux pump; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 36524 " 2217 UPDATE mexN resistance-nodulation-cell division (RND) antibiotic efflux pump; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 36524 " 2191 UPDATE AAC(6')-Iaj AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 2227 UPDATE VCC-1 VCC beta-lactamase; monobactam; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35987 " 3452 UPDATE OXA-288 OXA-286-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2240 UPDATE vanJ vanJ membrane protein; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35948 " 2248 UPDATE fusD Target protecting FusB-type protein conferring resistance to Fusidic acid; fusidane antibiotic; antibiotic target protection; ARO_category "DELETED 37139 " 3323 UPDATE QnrS11 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 2249 UPDATE LpxA Acinetobacter mutant Lpx gene conferring resistance to colistin; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 2251 UPDATE LpxC Acinetobacter mutant Lpx gene conferring resistance to colistin; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 2257 UPDATE Planobispora rosea EF-Tu mutants conferring resistance to inhibitor GE2270A elfamycin resistant EF-Tu; elfamycin antibiotic; antibiotic target alteration; ARO_category "DELETED 37636 " 2259 UPDATE mphG macrolide phosphotransferase (MPH); macrolide antibiotic; antibiotic inactivation; ARO_category "DELETED 35925 " 2224 UPDATE Pseudomonas aeruginosa oprD with mutation conferring resistance to imipenem Outer Membrane Porin (Opr); monobactam; carbapenem; cephalosporin; penicillin beta-lactam; reduced permeability to antibiotic; ARO_category "DELETED 36309 " 2241 UPDATE vanI glycopeptide resistance gene cluster; Van ligase; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 3480 UPDATE OXA-346 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3509 UPDATE OXA-439 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3539 UPDATE OXA-477 OXA-63-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2260 UPDATE vatF streptogramin vat acetyltransferase; streptogramin antibiotic; antibiotic inactivation; ARO_category "DELETED 37013 " 2261 UPDATE lnuE lincosamide nucleotidyltransferase (LNU); lincosamide antibiotic; antibiotic inactivation; ARO_category "DELETED 35964 " 2264 UPDATE oleC ATP-binding cassette (ABC) antibiotic efflux pump; macrolide antibiotic; antibiotic efflux; ARO_category "DELETED 37247 " 2265 UPDATE salA sal-type ABC-F protein; lincosamide antibiotic; streptogramin antibiotic; pleuromutilin antibiotic; antibiotic target protection; ARO_category "DELETED 35964 " 2274 UPDATE RlmA(II) TlrA-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with TlrA-like 23S rRNA methyltransferase UPDATED category_aro_description with 23S ribosomal RNA methyltransferases modify guanosine 748 (E. coli numbering) to confer resistance to some macrolides and lincosamides. DELETED 36284 " 3320 UPDATE QnrS10 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 2139 UPDATE vanS gene in vanD cluster vanS; glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 2201 UPDATE PvrR phenotypic variant regulator; aminoglycoside antibiotic; penicillin beta-lactam; tetracycline antibiotic; resistance by absence; ARO_category "DELETED 35932 " 2279 UPDATE Listeria monocytogenes mprF defensin resistant mprF; peptide antibiotic; antibiotic target alteration; ARO_category "DELETED 37037 " 2281 UPDATE Brucella suis mprF defensin resistant mprF; peptide antibiotic; antibiotic target alteration; ARO_category "DELETED 37037 " 2282 UPDATE Clostridium perfringens mprF defensin resistant mprF; peptide antibiotic; antibiotic target alteration; ARO_category "DELETED 37037 " 2283 UPDATE Streptococcus agalactiae mprF defensin resistant mprF; peptide antibiotic; antibiotic target alteration; ARO_category "DELETED 37037 " 2276 UPDATE Staphylococcus aureus ileS with mutation conferring resistance to mupirocin antibiotic-resistant isoleucyl-tRNA synthetase (ileS); mupirocin-like antibiotic; antibiotic target alteration; ARO_category "DELETED 36693 " 2284 UPDATE Escherichia coli murA with mutation conferring resistance to fosfomycin antibiotic-resistant murA transferase; phosphonic acid antibiotic; antibiotic target alteration; ARO_category "DELETED 35944 " 2290 UPDATE Mycobacterium tuberculosis intrinsic murA conferring resistance to fosfomycin antibiotic-resistant murA transferase; phosphonic acid antibiotic; antibiotic target alteration; ARO_category "DELETED 35944 " 3312 UPDATE Mycoplasma genitalium 23S rRNA mutations confers resistance to fluoroquinolone and macrolide antibiotics 23S rRNA with mutation conferring resistance to macrolide antibiotics; macrolide antibiotic; fluoroquinolone antibiotic; antibiotic target alteration; model_sequences; ARO_category "UPDATED NCBI_taxonomy_name with Mycoplasmoides genitalium G37 DELETED 35991 " 2277 UPDATE mphM macrolide phosphotransferase (MPH); macrolide antibiotic; antibiotic inactivation; ARO_category "DELETED 35925 " 3365 UPDATE cmlA8 major facilitator superfamily (MFS) antibiotic efflux pump; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 36524 " 2246 UPDATE vanR gene in vanI cluster glycopeptide resistance gene cluster; vanR; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 2243 UPDATE vanX gene in vanI cluster vanX; glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 2250 UPDATE fusC Target protecting FusB-type protein conferring resistance to Fusidic acid; fusidane antibiotic; antibiotic target protection; ARO_category "DELETED 37139 " 651 UPDATE Staphylococcus aureus mprF defensin resistant mprF; peptide antibiotic; antibiotic target alteration; ARO_category "DELETED 37037 " 2252 UPDATE LpxD Acinetobacter mutant Lpx gene conferring resistance to colistin; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 2263 UPDATE optrA Miscellaneous ABC-F subfamily ATP-binding cassette ribosomal protection proteins; oxazolidinone antibiotic; phenicol antibiotic; antibiotic target protection; ARO_category "DELETED 35989 " 2268 UPDATE eatAv Miscellaneous ABC-F subfamily ATP-binding cassette ribosomal protection proteins; pleuromutilin antibiotic; antibiotic target protection; ARO_category "DELETED 37716 " 2285 UPDATE Staphylococcus aureus murA with mutation conferring resistance to fosfomycin antibiotic-resistant murA transferase; phosphonic acid antibiotic; antibiotic target alteration; ARO_category "DELETED 35944 " 2286 UPDATE Borreliella burgdorferi murA with mutation conferring resistance to fosfomycin antibiotic-resistant murA transferase; phosphonic acid antibiotic; antibiotic target alteration; ARO_category "DELETED 35944 " 3321 UPDATE AAC(3)-IIe AAC(3); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 2288 UPDATE Mycobacterium tuberculosis variant bovis ndh with mutation conferring resistance to isoniazid antibiotic resistant ndh; isoniazid-like antibiotic; antibiotic target alteration; ARO_category "DELETED 36659 " 2324 UPDATE gadW resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; macrolide antibiotic; fluoroquinolone antibiotic; penicillin beta-lactam; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35925 " 2321 UPDATE cdeA multidrug and toxic compound extrusion (MATE) transporter; fluoroquinolone antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 35963 " 3481 UPDATE OXA-364 OXA-364-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2310 UPDATE Streptomyces cinnamoneus EF-Tu mutants conferring resistance to elfamycin elfamycin resistant EF-Tu; elfamycin antibiotic; antibiotic target alteration; ARO_category "DELETED 37633 " 2294 UPDATE Campylobacter jejuni gyrA conferring resistance to fluoroquinolones fluoroquinolone resistant gyrA; fluoroquinolone antibiotic; nybomycin-like antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3007157 UPDATED category_aro_cvterm_id with 45739 UPDATED category_aro_name with nybomycin-like antibiotic UPDATED category_aro_description with A group of antibiotics including nybomycin and its derivatives. UPDATED category_aro_class_name with Drug Class DELETED 35954 " 2313 UPDATE Enterococcus faecalis YvlB with mutation conferring daptomycin resistance daptomycin resistant YvlB; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35985 " 2312 UPDATE Enterococcus faecalis drmA with mutation conferring daptomycin resistance daptomycin resistant drmA; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35985 " 2302 UPDATE Enterococcus faecalis gdpD with mutation conferring daptomycin resistance daptomycin resistant gdpD; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35985 " 2314 UPDATE Acinetobacter baumannii gyrA conferring resistance to fluoroquinolones fluoroquinolone resistant gyrA; fluoroquinolone antibiotic; nybomycin-like antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3007157 UPDATED category_aro_cvterm_id with 45739 UPDATED category_aro_name with nybomycin-like antibiotic UPDATED category_aro_description with A group of antibiotics including nybomycin and its derivatives. UPDATED category_aro_class_name with Drug Class DELETED 35942 " 2305 UPDATE Enterococcus faecalis gshF with mutation conferring daptomycin resistance daptomycin resistant gshF; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35985 " 2301 UPDATE Enterococcus faecalis YybT with mutation conferring daptomycin resistance daptomycin resistant YybT; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35985 " 3510 UPDATE OXA-440 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2295 UPDATE Enterococcus faecium liaF mutant conferring daptomycin resistance daptomycin resistant liaF; antibiotic efflux regulatory protein; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35985 " 2296 UPDATE Enterococcus faecalis liaS mutant conferring daptomycin resistance daptomycin resistant liaS; antibiotic efflux regulatory protein; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35985 " 2297 UPDATE Enterococcus faecalis liaR mutant conferring daptomycin resistance daptomycin resistant liaR; antibiotic efflux regulatory protein; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35985 " 3540 UPDATE OXA-478 OXA-63-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3319 UPDATE AAC(6')-Ian AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 2331 UPDATE kdpE kdpDE; antibiotic efflux regulatory protein; aminoglycoside antibiotic; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35966 " 3322 UPDATE AAC(3)-IId AAC(3); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 3324 UPDATE Erm(49) Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35925 " 2307 UPDATE carO CarO porin; carbapenem; reduced permeability to antibiotic; resistance by absence; ARO_category "DELETED 35990 " 2293 UPDATE Bacillus subtilis pgsA with mutation conferring resistance to daptomycin daptomycin resistant pgsA; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35985 " 2299 UPDATE Staphylococcus aureus walK with mutation conferring resistance to daptomycin daptomycin resistant walK; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35985 " 2315 UPDATE Acinetobacter baumannii parC conferring resistance to fluoroquinolones fluoroquinolone resistant parC; fluoroquinolone antibiotic; antibiotic target alteration; ARO_category "DELETED 35942 " 2308 UPDATE Acinetobacter baumannii OprD conferring resistance to imipenem Outer Membrane Porin (Opr); monobactam; carbapenem; cephalosporin; penicillin beta-lactam; reduced permeability to antibiotic; resistance by absence; ARO_category "DELETED 36309 " 2328 UPDATE MUS-2 MUS beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35981 " 3328 UPDATE AAC(6')-Im AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 3334 UPDATE AAC(6')-Il AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 3335 UPDATE qnrE1 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 3336 UPDATE qnrE2 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 3337 UPDATE Corynebacterium striatum tetA major facilitator superfamily (MFS) antibiotic efflux pump; penicillin beta-lactam; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 3339 UPDATE dfrA15b trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 3341 UPDATE Erm(K) Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35925 " 3343 UPDATE dfrA6 from Proteus mirabilis trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 3344 UPDATE dfrI trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 3348 UPDATE cfr(B) Cfr-like 23S rRNA methyltransferase; lincosamide antibiotic; streptogramin antibiotic; oxazolidinone antibiotic; phenicol antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Cfr-like 23S rRNA methyltransferase DELETED 35983 " 1670 UPDATE nalC resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; macrolide antibiotic; fluoroquinolone antibiotic; monobactam; carbapenem; cephalosporin; penicillin beta-lactam; tetracycline antibiotic; peptide antibiotic; aminocoumarin antibiotic; diaminopyrimidine antibiotic; sulfonamide antibiotic; phenicol antibiotic; nonribosomal peptide antibiotics; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 0010004 UPDATED category_aro_cvterm_id with 36005 UPDATED category_aro_name with resistance-nodulation-cell division (RND) antibiotic efflux pump UPDATED category_aro_description with Directed pumping of antibiotic out of a cell to confer resistance. Resistance-nodulation-division (RND) proteins are found in both prokaryotic and eukaryotic cells and have diverse substrate specificities and physiological roles. However, there are relatively few RND transporters and they are secondary transporters, energized not by ATP binding/hydrolysis but by proton movement down the transmembrane electrochemical gradient. UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_accession with 0000000 UPDATED category_aro_cvterm_id with 35919 UPDATED category_aro_name with macrolide antibiotic UPDATED category_aro_description with Macrolides are a group of drugs (typically antibiotics) that have a large macrocyclic lactone ring of 12-16 carbons to which one or more deoxy sugars, usually cladinose and desosamine, may be attached. Macrolides bind to the 50S-subunit of bacterial ribosomes, inhibiting the synthesis of vital proteins. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 0000001 UPDATED category_aro_cvterm_id with 35920 UPDATED category_aro_name with fluoroquinolone antibiotic UPDATED category_aro_description with The fluoroquinolones are a family of synthetic broad-spectrum antibiotics that are 4-quinolone-3-carboxylates. These compounds interact with topoisomerase II (DNA gyrase) to disrupt bacterial DNA replication, damage DNA, and cause cell death. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 0000004 UPDATED category_aro_cvterm_id with 35923 UPDATED category_aro_name with monobactam UPDATED category_aro_description with Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 0000020 UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_name with carbapenem UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 0000032 UPDATED category_aro_cvterm_id with 35951 UPDATED category_aro_name with cephalosporin UPDATED category_aro_description with Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000008 UPDATED category_aro_cvterm_id with 36017 UPDATED category_aro_name with penicillin beta-lactam UPDATED category_aro_description with Penicilins (Penams) are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. Penicillin-like antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000050 UPDATED category_aro_cvterm_id with 36189 UPDATED category_aro_name with tetracycline antibiotic UPDATED category_aro_description with These antibiotics are derived from tetracycline, a polyketide antibiotic that inhibits the 30S subunit of bacterial ribosomes. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000103 UPDATED category_aro_cvterm_id with 36242 UPDATED category_aro_name with aminocoumarin antibiotic UPDATED category_aro_description with Aminocoumarin antibiotics bind DNA gyrase subunit B to inhibit ATP-dependent DNA supercoiling. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000171 UPDATED category_aro_cvterm_id with 36310 UPDATED category_aro_name with diaminopyrimidine antibiotic UPDATED category_aro_description with Diaminopyrimidines are a class of organic compounds containing a pyrimidine ring substituted by two amine groups. They are inhibitors of dihydrofolate reductase, an enzyme critical for DNA synthesis. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000282 UPDATED category_aro_cvterm_id with 36421 UPDATED category_aro_name with sulfonamide antibiotic UPDATED category_aro_description with Sulfonamides are broad spectrum, synthetic antibiotics that contain the sulfonamide group. Sulfonamides inhibit dihydropteroate synthase, which catalyzes the conversion of p-aminobenzoic acid to dihydropteroic acid as part of the tetrahydrofolic acid biosynthetic pathway. Tetrahydrofolic acid is essential for folate synthesis, a precursor of many nucleotides and amino acids. Many sulfamides are taken with trimethoprim, an inhibitor of dihydrofolate reductase, also disturbing the trihydrofolic acid synthesis pathway. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000387 UPDATED category_aro_cvterm_id with 36526 UPDATED category_aro_name with phenicol antibiotic UPDATED category_aro_description with Phenicols are broad spectrum bacteriostatic antibiotics acting on bacterial protein synthesis. More specifically, the phenicols block peptide elongation by binding to the peptidyltansferase centre of the 70S ribosome. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36590 " 2373 UPDATE Escherichia coli UhpT with mutation conferring resistance to fosfomycin antibiotic-resistant UhpT; phosphonic acid antibiotic; antibiotic target alteration; ARO_category "DELETED 35944 " 383 UPDATE Pseudomonas mutant PhoQ conferring resistance to colistin ATP-binding cassette (ABC) antibiotic efflux pump; pmr phosphoethanolamine transferase; transmembrane protein conferring colistin resistance; antibiotic efflux regulatory protein; macrolide antibiotic; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; antibiotic efflux; resistance by absence; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35925 " 3325 UPDATE QnrS12 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 2383 UPDATE ANT(4')-Ib ANT(4'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 2387 UPDATE Erm(47) Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35925 " 3342 UPDATE dfrA3b trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 2374 UPDATE Escherichia coli uhpA with mutation conferring resistance to fosfomycin antibiotic-resistant UhpT; UhpA response regulator of fosfomycin resistance; phosphonic acid antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3004249 UPDATED category_aro_cvterm_id with 41413 UPDATED category_aro_name with UhpA response regulator of fosfomycin resistance UPDATED category_aro_description with UhpA acts as a positive regulator of UhpT, which is a transporter to bring fosfomycin drugs into bacterial cells. Mutations in UhpA that negatively impact the expression of UhpT can confer resistance. UPDATED category_aro_class_name with AMR Gene Family DELETED 35944 " 2379 UPDATE Escherichia coli cyaA with mutation conferring resistance to fosfomycin antibiotic-resistant cya adenylate cyclase; phosphonic acid antibiotic; antibiotic target alteration; ARO_category "DELETED 35944 " 2396 UPDATE OXA-368 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2398 UPDATE TEM-220 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 2399 UPDATE oqxA resistance-nodulation-cell division (RND) antibiotic efflux pump; fluoroquinolone antibiotic; glycylcycline; tetracycline antibiotic; diaminopyrimidine antibiotic; nitrofuran antibiotic; antibiotic efflux; ARO_category "DELETED 35949 " 2400 UPDATE oqxB resistance-nodulation-cell division (RND) antibiotic efflux pump; fluoroquinolone antibiotic; glycylcycline; tetracycline antibiotic; diaminopyrimidine antibiotic; nitrofuran antibiotic; antibiotic efflux; ARO_category "DELETED 35949 " 3398 UPDATE aadA10 ANT(3''); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35957 " 660 UPDATE Streptococcus pneumoniae parC conferring resistance to fluoroquinolones fluoroquinolone resistant parC; fluoroquinolone antibiotic; antibiotic target alteration; ARO_category "DELETED 35942 " 2104 UPDATE Ureaplasma urealyticum parC conferring resistance to fluoroquinolones fluoroquinolone resistant parC; fluoroquinolone antibiotic; antibiotic target alteration; ARO_category "DELETED 35942 " 2401 UPDATE Haemophilus parainfluenzae gyrA conferring resistance to fluoroquinolones fluoroquinolone resistant gyrA; fluoroquinolone antibiotic; nybomycin-like antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3007157 UPDATED category_aro_cvterm_id with 45739 UPDATED category_aro_name with nybomycin-like antibiotic UPDATED category_aro_description with A group of antibiotics including nybomycin and its derivatives. UPDATED category_aro_class_name with Drug Class DELETED 35954 " 2402 UPDATE Haemophilus parainfluenzae parC conferring resistance to fluoroquinolones fluoroquinolone resistant parC; fluoroquinolone antibiotic; antibiotic target alteration; ARO_category "DELETED 35954 " 2403 UPDATE Salmonella enterica gyrA conferring resistance to fluoroquinolones fluoroquinolone resistant gyrA; fluoroquinolone antibiotic; nybomycin-like antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3007157 UPDATED category_aro_cvterm_id with 45739 UPDATED category_aro_name with nybomycin-like antibiotic UPDATED category_aro_description with A group of antibiotics including nybomycin and its derivatives. UPDATED category_aro_class_name with Drug Class DELETED 35954 " 2406 UPDATE rpsJ tetracycline-resistant ribosomal protection protein; tetracycline antibiotic; antibiotic target protection; ARO_category "DELETED 35968 " 2407 UPDATE Capnocytophaga gingivalis gyrA conferring resistance to fluoroquinolones fluoroquinolone resistant gyrA; fluoroquinolone antibiotic; nybomycin-like antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3007157 UPDATED category_aro_cvterm_id with 45739 UPDATED category_aro_name with nybomycin-like antibiotic UPDATED category_aro_description with A group of antibiotics including nybomycin and its derivatives. UPDATED category_aro_class_name with Drug Class DELETED 35954 " 3454 UPDATE OXA-291 OXA-286-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2410 UPDATE Salmonella enterica parC conferring resistance to fluoroquinolones fluoroquinolone resistant parC; fluoroquinolone antibiotic; antibiotic target alteration; ARO_category "DELETED 35954 " 2395 UPDATE apmA AAC(2'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35955 " 2411 UPDATE Shigella flexneri gyrA conferring resistance to fluoroquinolones fluoroquinolone resistant gyrA; fluoroquinolone antibiotic; nybomycin-like antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3007157 UPDATED category_aro_cvterm_id with 45739 UPDATED category_aro_name with nybomycin-like antibiotic UPDATED category_aro_description with A group of antibiotics including nybomycin and its derivatives. UPDATED category_aro_class_name with Drug Class DELETED 37005 " 2412 UPDATE Shigella flexneri parC conferring resistance to fluoroquinolones fluoroquinolone resistant parC; fluoroquinolone antibiotic; antibiotic target alteration; ARO_category "DELETED 37005 " 2409 UPDATE Neisseria meningititis PBP2 conferring resistance to beta-lactam penicillin-binding protein with mutation conferring resistance to beta-lactam antibiotics; monobactam; cephalosporin; penicillin beta-lactam; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 0000004 UPDATED category_aro_cvterm_id with 35923 UPDATED category_aro_name with monobactam UPDATED category_aro_description with Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_name with penicillin-binding protein with mutation conferring resistance to beta-lactam antibiotics DELETED 35979 " 2416 UPDATE abcA ATP-binding cassette (ABC) antibiotic efflux pump; cephalosporin; penicillin beta-lactam; peptide antibiotic; moenomycin antibiotic; nonribosomal peptide antibiotics; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35934 " 3482 UPDATE OXA-372 OXA-372-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1035 UPDATE Streptococcus pneumoniae PBP2b conferring resistance to amoxicillin penicillin-binding protein with mutation conferring resistance to beta-lactam antibiotics; monobactam; cephalosporin; penicillin beta-lactam; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 0000004 UPDATED category_aro_cvterm_id with 35923 UPDATED category_aro_name with monobactam UPDATED category_aro_description with Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_name with penicillin-binding protein with mutation conferring resistance to beta-lactam antibiotics DELETED 35981 " 2386 UPDATE cipA Cfr-like 23S rRNA methyltransferase; lincosamide antibiotic; streptogramin antibiotic; oxazolidinone antibiotic; phenicol antibiotic; pleuromutilin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Cfr-like 23S rRNA methyltransferase DELETED 35964 " 3511 UPDATE OXA-441 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3541 UPDATE OXA-479 OXA-63-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2394 UPDATE Staphylococcus aureus menA with mutation conferring resistance to lysocin lysocin resistant menA; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 40623 " 2380 UPDATE Staphylococcus aureus GlpT with mutation conferring resistance to fosfomycin antibiotic-resistant GlpT; phosphonic acid antibiotic; antibiotic target alteration; ARO_category "DELETED 35944 " 2462 UPDATE Cutibacterium acnes gyrA conferring resistance to fluoroquinolones fluoroquinolone resistant gyrA; fluoroquinolone antibiotic; nybomycin-like antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3007157 UPDATED category_aro_cvterm_id with 45739 UPDATED category_aro_name with nybomycin-like antibiotic UPDATED category_aro_description with A group of antibiotics including nybomycin and its derivatives. UPDATED category_aro_class_name with Drug Class DELETED 35954 " 2381 UPDATE Staphylococcus aureus UhpT with mutation conferring resistance to fosfomycin antibiotic-resistant UhpT; phosphonic acid antibiotic; antibiotic target alteration; ARO_category "DELETED 35944 " 3326 UPDATE QnrS15 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 3351 UPDATE Erm(O)-lrm Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35925 " 2421 UPDATE efrA ATP-binding cassette (ABC) antibiotic efflux pump; macrolide antibiotic; fluoroquinolone antibiotic; rifamycin antibiotic; antibiotic efflux; ARO_category "DELETED 35925 " 2422 UPDATE efrB ATP-binding cassette (ABC) antibiotic efflux pump; macrolide antibiotic; fluoroquinolone antibiotic; rifamycin antibiotic; antibiotic efflux; ARO_category "DELETED 35925 " 2423 UPDATE msbA ATP-binding cassette (ABC) antibiotic efflux pump; nitroimidazole antibiotic; antibiotic efflux; ARO_category "DELETED 37033 " 2425 UPDATE hmrM multidrug and toxic compound extrusion (MATE) transporter; fluoroquinolone antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 35963 " 3353 UPDATE Clostridioides difficile 23S rRNA with mutation conferring resistance to erythromycin and clindamycin 23S rRNA with mutation conferring resistance to macrolide antibiotics; macrolide antibiotic; lincosamide antibiotic; antibiotic target alteration; ARO_category "DELETED 35925 " 2426 UPDATE efmA major facilitator superfamily (MFS) antibiotic efflux pump; macrolide antibiotic; fluoroquinolone antibiotic; antibiotic efflux; ARO_category "DELETED 35925 " 2427 UPDATE efpA major facilitator superfamily (MFS) antibiotic efflux pump; rifamycin antibiotic; isoniazid-like antibiotic; antibiotic efflux; ARO_category "DELETED 36308 " 2428 UPDATE farA major facilitator superfamily (MFS) antibiotic efflux pump; antibacterial free fatty acids; antibiotic efflux; ARO_category "DELETED 40728 " 2429 UPDATE farB major facilitator superfamily (MFS) antibiotic efflux pump; antibacterial free fatty acids; antibiotic efflux; ARO_category "DELETED 40728 " 2430 UPDATE hp1181 major facilitator superfamily (MFS) antibiotic efflux pump; fluoroquinolone antibiotic; tetracycline antibiotic; nitroimidazole antibiotic; antibiotic efflux; ARO_category "DELETED 35954 " 2435 UPDATE lmrP major facilitator superfamily (MFS) antibiotic efflux pump; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35925 " 1600 UPDATE Pseudomonas mutant PhoP conferring resistance to colistin ATP-binding cassette (ABC) antibiotic efflux pump; pmr phosphoethanolamine transferase; transmembrane protein conferring colistin resistance; antibiotic efflux regulatory protein; macrolide antibiotic; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; antibiotic efflux; resistance by absence; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35925 " 2433 UPDATE lfrA major facilitator superfamily (MFS) antibiotic efflux pump; fluoroquinolone antibiotic; antibiotic efflux; ARO_category "DELETED 35954 " 2436 UPDATE D-Ala-D-Ala ligase Van ligase; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 3355 UPDATE catII from Escherichia coli K-12 chloramphenicol acetyltransferase (CAT); phenicol antibiotic; antibiotic inactivation; ARO_category "DELETED 36524 " 3357 UPDATE catA4 chloramphenicol acetyltransferase (CAT); phenicol antibiotic; antibiotic inactivation; ARO_category "DELETED 36524 " 3358 UPDATE catA8 chloramphenicol acetyltransferase (CAT); phenicol antibiotic; antibiotic inactivation; ARO_category "DELETED 36524 " 3359 UPDATE Mef(En2) major facilitator superfamily (MFS) antibiotic efflux pump; macrolide antibiotic; lincosamide antibiotic; antibiotic efflux; ARO_category "DELETED 35964 " 3360 UPDATE catB11 chloramphenicol acetyltransferase (CAT); phenicol antibiotic; antibiotic inactivation; ARO_category "DELETED 36524 " 3361 UPDATE lin lincosamide nucleotidyltransferase (LNU); lincosamide antibiotic; antibiotic inactivation; ARO_category "DELETED 35964 " 3362 UPDATE Staphylococcus aureus FosB fosfomycin thiol transferase; phosphonic acid antibiotic; antibiotic inactivation; ARO_category "DELETED 35944 " 3363 UPDATE MCR-3.3 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 3364 UPDATE FusF Target protecting FusB-type protein conferring resistance to Fusidic acid; fusidane antibiotic; antibiotic target protection; ARO_category "DELETED 37139 " 3367 UPDATE Staphylococcus aureus norA major facilitator superfamily (MFS) antibiotic efflux pump; fluoroquinolone antibiotic; antibiotic efflux; ARO_category "DELETED 35942 " 2432 UPDATE Klebsiella pneumoniae OmpK35 General Bacterial Porin with reduced permeability to beta-lactams; monobactam; carbapenem; cephalosporin; penicillin beta-lactam; reduced permeability to antibiotic; resistance by absence; ARO_category "DELETED 35927 " 2434 UPDATE Klebsiella pneumoniae OmpK36 General Bacterial Porin with reduced permeability to beta-lactams; monobactam; carbapenem; cephalosporin; penicillin beta-lactam; reduced permeability to antibiotic; resistance by absence; ARO_category "DELETED 35979 " 3369 UPDATE FosB1 fosfomycin thiol transferase; phosphonic acid antibiotic; antibiotic inactivation; ARO_category "DELETED 35944 " 3370 UPDATE FosB4 fosfomycin thiol transferase; phosphonic acid antibiotic; antibiotic inactivation; ARO_category "DELETED 35944 " 3327 UPDATE AAC(2')-IIa AAC(2'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 37695 " 3356 UPDATE OXA-296 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 3269 UPDATE Clostridioides difficile rpoB with mutation conferring resistance to rifampicin rifamycin-resistant beta-subunit of RNA polymerase (rpoB); rifamycin antibiotic; antibiotic target alteration; antibiotic target replacement; model_param; ARO_category "UPDATED 8829 with S550Y DELETED 36308 " 3368 UPDATE emtA TlrA-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; orthosomycin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with TlrA-like 23S rRNA methyltransferase UPDATED category_aro_description with 23S ribosomal RNA methyltransferases modify guanosine 748 (E. coli numbering) to confer resistance to some macrolides and lincosamides. DELETED 45749 " 3371 UPDATE FosB5 fosfomycin thiol transferase; phosphonic acid antibiotic; antibiotic inactivation; ARO_category "DELETED 35944 " 3374 UPDATE aphA15 APH(3'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35924 " 3455 UPDATE OXA-292 OXA-286-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3483 UPDATE OXA-373 OXA-211-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3512 UPDATE OXA-442 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3391 UPDATE MCR-3.12 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 3397 UPDATE sta streptothricin acetyltransferase (SAT); nucleoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35931 " 2144 UPDATE Mycobacterium tuberculosis variant bovis embB with mutation conferring resistance to ethambutol ethambutol resistant embB; polyamine antibiotic; antibiotic target alteration; ARO_category "DELETED 36636 " 2476 UPDATE Halobacterium salinarum 16S rRNA mutation conferring resistance to pactamycin 16S rRNA with mutation conferring resistance to pactamycin; pactamycin-like antibiotic; antibiotic target alteration; ARO_category "DELETED 40804 " 2478 UPDATE Helicobacter pylori 16S rRNA mutation conferring resistance to tetracycline 16S rRNA with mutation conferring resistance to tetracycline derivatives; tetracycline antibiotic; antibiotic target alteration; model_param; ARO_category "UPDATED 4761 with a965g UPDATED 4760 with a926g DELETED 35968 " 3456 UPDATE OXA-293 OXA-286-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3716 UPDATE Mycobacterium tuberculosis Rv0191 mutations confer resistance to pyrazinamide pyrazinamide resistant Rv0191; pyrazine antibiotic; antibiotic target alteration; ARO_category "DELETED 39997 " 3726 UPDATE Mycobacterium tuberculosis inbR mutations conferring resistance to isoniazid isoniazid resistant inbR; isoniazid-like antibiotic; antibiotic target alteration; ARO_category "DELETED 36659 " 2812 UPDATE Mycobacteroides chelonae 23S rRNA with mutation conferring resistance to clarithromycin 23S rRNA with mutation conferring resistance to macrolide antibiotics; macrolide antibiotic; antibiotic target alteration; ARO_category "DELETED 35982 " 3366 UPDATE pexA major facilitator superfamily (MFS) antibiotic efflux pump; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 36524 " 3372 UPDATE FosB6 fosfomycin thiol transferase; phosphonic acid antibiotic; antibiotic inactivation; ARO_category "DELETED 35944 " 3376 UPDATE rmtD2 16S rRNA methyltransferase (G1405); aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35932 " 3379 UPDATE APH(3')-VIIIa APH(3'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35932 " 2519 UPDATE LlmA 23S ribosomal RNA methyltransferase Llm 23S ribosomal RNA methyltransferase; lincosamide antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_description with A family of RlmK-like lincosamide-resistant 23S rRNA methyltransferases. The only member of the family discovered so far was isolated from Paenibacillus sp. LC231, a strain found in Lechuguilla Cave, NM, USA with resistance exclusively observed for clindamycin. DELETED 35983 " 2520 UPDATE CatU chloramphenicol acetyltransferase (CAT); phenicol antibiotic; antibiotic inactivation; ARO_category "DELETED 36521 " 2521 UPDATE BahA Bah amidohydrolase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35959 " 2522 UPDATE TaeA ATP-binding cassette (ABC) antibiotic efflux pump; pleuromutilin antibiotic; antibiotic efflux; ARO_category "DELETED 37716 " 2523 UPDATE VatI streptogramin vat acetyltransferase; streptogramin antibiotic; antibiotic inactivation; ARO_category "DELETED 37013 " 2524 UPDATE AAC(2')-IIb AAC(2'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 37695 " 2525 UPDATE AAC(6')-34 AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35966 " 2527 UPDATE mphI macrolide phosphotransferase (MPH); macrolide antibiotic; antibiotic inactivation; ARO_category "DELETED 35925 " 2528 UPDATE rphB rifampin phosphotransferase; rifamycin antibiotic; antibiotic inactivation; ARO_category "DELETED 36308 " 2529 UPDATE cpaA cpa acetyltransferase; aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 40875 " 3382 UPDATE aadS ANT(6); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35958 " 3384 UPDATE MCR-1.5 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 3387 UPDATE MCR-1.11 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 3380 UPDATE Clostridioides difficile rpoC with mutation conferring resistance to vancomycin vancomycin-resistant beta prime subunit of RNA polymerase (rpoC); peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 3381 UPDATE aadA27 ANT(3''); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35957 " 2717 UPDATE MuxA resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; monobactam; tetracycline antibiotic; aminocoumarin antibiotic; antibiotic efflux; ARO_category "DELETED 35925 " 2517 UPDATE tetA(58) major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 2526 UPDATE vgbC streptogramin vgb lyase; streptogramin antibiotic; antibiotic inactivation; ARO_category "DELETED 36722 " 3383 UPDATE MCR-9.1 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 3399 UPDATE aadA8b ANT(3''); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35957 " 3400 UPDATE vga(E) Staphylococcus cohnii vga-type ABC-F protein; lincosamide antibiotic; streptogramin antibiotic; pleuromutilin antibiotic; antibiotic target protection; ARO_category "DELETED 35964 " 3485 UPDATE OXA-392 OXA-1-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2550 UPDATE Clostridioides difficile gyrA conferring resistance to fluoroquinolones fluoroquinolone resistant gyrA; fluoroquinolone antibiotic; nybomycin-like antibiotic; antibiotic target alteration; model_param; ARO_category "UPDATED 8845 with P116A UPDATED category_aro_accession with 3007157 UPDATED category_aro_cvterm_id with 45739 UPDATED category_aro_name with nybomycin-like antibiotic UPDATED category_aro_description with A group of antibiotics including nybomycin and its derivatives. UPDATED category_aro_class_name with Drug Class DELETED 35954 " 3373 UPDATE FosD fosfomycin thiol transferase; phosphonic acid antibiotic; antibiotic inactivation; ARO_category "DELETED 35944 " 3377 UPDATE rmtE 16S rRNA methyltransferase (G1405); aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35932 " 3385 UPDATE MCR-1.7 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 3388 UPDATE MCR-1.12 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 3392 UPDATE MCR-4.2 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 3457 UPDATE OXA-294 OXA-294-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3484 UPDATE tva(A) Miscellaneous ABC-F subfamily ATP-binding cassette ribosomal protection proteins; pleuromutilin antibiotic; antibiotic target protection; ARO_category "DELETED 37716 " 3486 UPDATE OXA-400 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2551 UPDATE glycopeptide resistance gene cluster VanI glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; model_param; ARO_category "UPDATED 4683 with D71G UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 3513 UPDATE OXA-443 OXA-22-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3543 UPDATE OXA-482 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3717 UPDATE Mycobacterium tuberculosis Rv1667 mutations confer resistance to pyrazinamide pyrazinamide resistant Rv1667; pyrazine antibiotic; antibiotic target alteration; model_param; ARO_category "UPDATED 13187 with D71G DELETED 39997 " 3727 UPDATE Mycobacterium tuberculosis mshA mutations conferring resistance to isoniazid isoniazid resistant mshA; isoniazid-like antibiotic; antibiotic target alteration; ARO_category "DELETED 36659 " 3378 UPDATE rmtE2 16S rRNA methyltransferase (G1405); aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35932 " 3386 UPDATE MCR-1.8 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 3389 UPDATE MCR-1.13 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 3393 UPDATE MCR-4.3 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 3405 UPDATE OXA-402 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3428 UPDATE OXA-261 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3458 UPDATE OXA-295 OXA-294-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3487 UPDATE OXA-401 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3402 UPDATE tet(X4) tetracycline inactivation enzyme; glycylcycline; tetracycline antibiotic; antibiotic inactivation; ARO_category "DELETED 35949 " 3514 UPDATE OXA-444 OXA-60-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3544 UPDATE OXA-483 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2098 UPDATE Mycolicibacterium smegmatis 16S rRNA (rrsB) mutation conferring resistance to viomycin 16s rRNA with mutation conferring resistance to peptide antibiotics; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35937 " 3718 UPDATE Mycobacterium tuberculosis Rv2731 mutations confer resistance to pyrazinamide pyrazinamide resistant Rv2731; pyrazine antibiotic; antibiotic target alteration; ARO_category "DELETED 39997 " 3390 UPDATE MCR-3.4 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 3394 UPDATE MCR-4.4 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 3406 UPDATE OXA-140 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 3429 UPDATE OXA-262 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3459 UPDATE OXA-297 OXA-294-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3488 UPDATE OXA-403 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 515 UPDATE mgtA mgt macrolide glycotransferase; macrolide antibiotic; antibiotic inactivation; ARO_category "DELETED 35925 " 3395 UPDATE MCR-4.5 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 3407 UPDATE OXA-103 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3430 UPDATE OXA-263 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3460 UPDATE OXA-298 OXA-294-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2685 UPDATE Pseudomonas aeruginosa CpxR resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; macrolide antibiotic; fluoroquinolone antibiotic; monobactam; aminoglycoside antibiotic; carbapenem; cephalosporin; penicillin beta-lactam; tetracycline antibiotic; peptide antibiotic; aminocoumarin antibiotic; diaminopyrimidine antibiotic; sulfonamide antibiotic; phenicol antibiotic; nonribosomal peptide antibiotics; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35924 " 3489 UPDATE OXA-404 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3515 UPDATE OXA-446 OXA-184-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3545 UPDATE OXA-484 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3729 UPDATE Mycobacterium tuberculosis mshC mutations conferring resistance to isoniazid isoniazid resistant mshC; isoniazid-like antibiotic; antibiotic target alteration; ARO_category "DELETED 36659 " 2646 UPDATE tetB(60) ATP-binding cassette (ABC) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 2643 UPDATE tetA(46) ATP-binding cassette (ABC) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 2644 UPDATE tetB(46) ATP-binding cassette (ABC) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 2645 UPDATE tetA(60) ATP-binding cassette (ABC) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 522 UPDATE floR major facilitator superfamily (MFS) antibiotic efflux pump; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 36524 " 2716 UPDATE OpmB resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; monobactam; tetracycline antibiotic; aminocoumarin antibiotic; antibiotic efflux; ARO_category "DELETED 35925 " 3396 UPDATE MCR-5.2 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 2654 UPDATE adeL resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; fluoroquinolone antibiotic; tetracycline antibiotic; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35968 " 2655 UPDATE Pseudomonas aeruginosa emrE small multidrug resistance (SMR) antibiotic efflux pump; aminoglycoside antibiotic; antibiotic efflux; ARO_category "DELETED 35933 " 2656 UPDATE Escherichia coli emrE small multidrug resistance (SMR) antibiotic efflux pump; macrolide antibiotic; antibiotic efflux; ARO_category "DELETED 35925 " 3408 UPDATE OXA-122 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2659 UPDATE Klebsiella pneumoniae acrA resistance-nodulation-cell division (RND) antibiotic efflux pump; fluoroquinolone antibiotic; cephalosporin; glycylcycline; penicillin beta-lactam; tetracycline antibiotic; rifamycin antibiotic; phenicol antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 35949 " 2660 UPDATE Enterobacter cloacae acrA resistance-nodulation-cell division (RND) antibiotic efflux pump; fluoroquinolone antibiotic; cephalosporin; glycylcycline; penicillin beta-lactam; tetracycline antibiotic; rifamycin antibiotic; phenicol antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 35949 " 2661 UPDATE Escherichia coli acrA resistance-nodulation-cell division (RND) antibiotic efflux pump; fluoroquinolone antibiotic; cephalosporin; glycylcycline; penicillin beta-lactam; tetracycline antibiotic; rifamycin antibiotic; phenicol antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 35949 " 3431 UPDATE OXA-264 OXA-214-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3461 UPDATE OXA-299 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 3490 UPDATE OXA-405 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3516 UPDATE OXA-447 OXA-184-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3546 UPDATE OXA-485 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 320 UPDATE Streptococcus pneumoniae PBP2x conferring resistance to amoxicillin penicillin-binding protein with mutation conferring resistance to beta-lactam antibiotics; monobactam; cephalosporin; penicillin beta-lactam; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 0000004 UPDATED category_aro_cvterm_id with 35923 UPDATED category_aro_name with monobactam UPDATED category_aro_description with Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_name with penicillin-binding protein with mutation conferring resistance to beta-lactam antibiotics DELETED 35981 " 3720 UPDATE Mycobacterium tuberculosis Rv3169 mutations confer resistance to pyrazinamide pyrazinamide resistant Rv3169; pyrazine antibiotic; antibiotic target alteration; model_param; ARO_category "UPDATED param_type with single resistance variant UPDATED param_description with A sequence change where, compared to a reference sequence, one amino acid is replaced by one other amino acid that is associated with elevated resistance to antibiotic(s) relative to wild type. Format is given as [wild-type][position][mutation], e.g. R184Q or R447Var where Var represents any possible substitution. UPDATED param_type_id with 36301 UPDATED 9733 with N56S DELETED 39997 " 2303 UPDATE bcr-1 major facilitator superfamily (MFS) antibiotic efflux pump; bicyclomycin-like antibiotic; antibiotic efflux; ARO_category "DELETED 35972 " 2705 UPDATE MexEF-OprN with MexS mutations conferring resistance to chloramphenicol, ciprofloxacin, and trimethoprim resistance-nodulation-cell division (RND) antibiotic efflux pump; fluoroquinolone antibiotic; diaminopyrimidine antibiotic; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 35954 " 1213 UPDATE nalD resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; macrolide antibiotic; fluoroquinolone antibiotic; monobactam; carbapenem; cephalosporin; penicillin beta-lactam; tetracycline antibiotic; peptide antibiotic; aminocoumarin antibiotic; diaminopyrimidine antibiotic; sulfonamide antibiotic; phenicol antibiotic; nonribosomal peptide antibiotics; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 0010004 UPDATED category_aro_cvterm_id with 36005 UPDATED category_aro_name with resistance-nodulation-cell division (RND) antibiotic efflux pump UPDATED category_aro_description with Directed pumping of antibiotic out of a cell to confer resistance. Resistance-nodulation-division (RND) proteins are found in both prokaryotic and eukaryotic cells and have diverse substrate specificities and physiological roles. However, there are relatively few RND transporters and they are secondary transporters, energized not by ATP binding/hydrolysis but by proton movement down the transmembrane electrochemical gradient. UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_accession with 0000000 UPDATED category_aro_cvterm_id with 35919 UPDATED category_aro_name with macrolide antibiotic UPDATED category_aro_description with Macrolides are a group of drugs (typically antibiotics) that have a large macrocyclic lactone ring of 12-16 carbons to which one or more deoxy sugars, usually cladinose and desosamine, may be attached. Macrolides bind to the 50S-subunit of bacterial ribosomes, inhibiting the synthesis of vital proteins. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 0000001 UPDATED category_aro_cvterm_id with 35920 UPDATED category_aro_name with fluoroquinolone antibiotic UPDATED category_aro_description with The fluoroquinolones are a family of synthetic broad-spectrum antibiotics that are 4-quinolone-3-carboxylates. These compounds interact with topoisomerase II (DNA gyrase) to disrupt bacterial DNA replication, damage DNA, and cause cell death. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 0000004 UPDATED category_aro_cvterm_id with 35923 UPDATED category_aro_name with monobactam UPDATED category_aro_description with Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 0000020 UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_name with carbapenem UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 0000032 UPDATED category_aro_cvterm_id with 35951 UPDATED category_aro_name with cephalosporin UPDATED category_aro_description with Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000008 UPDATED category_aro_cvterm_id with 36017 UPDATED category_aro_name with penicillin beta-lactam UPDATED category_aro_description with Penicilins (Penams) are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. Penicillin-like antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000050 UPDATED category_aro_cvterm_id with 36189 UPDATED category_aro_name with tetracycline antibiotic UPDATED category_aro_description with These antibiotics are derived from tetracycline, a polyketide antibiotic that inhibits the 30S subunit of bacterial ribosomes. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000103 UPDATED category_aro_cvterm_id with 36242 UPDATED category_aro_name with aminocoumarin antibiotic UPDATED category_aro_description with Aminocoumarin antibiotics bind DNA gyrase subunit B to inhibit ATP-dependent DNA supercoiling. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000171 UPDATED category_aro_cvterm_id with 36310 UPDATED category_aro_name with diaminopyrimidine antibiotic UPDATED category_aro_description with Diaminopyrimidines are a class of organic compounds containing a pyrimidine ring substituted by two amine groups. They are inhibitors of dihydrofolate reductase, an enzyme critical for DNA synthesis. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000282 UPDATED category_aro_cvterm_id with 36421 UPDATED category_aro_name with sulfonamide antibiotic UPDATED category_aro_description with Sulfonamides are broad spectrum, synthetic antibiotics that contain the sulfonamide group. Sulfonamides inhibit dihydropteroate synthase, which catalyzes the conversion of p-aminobenzoic acid to dihydropteroic acid as part of the tetrahydrofolic acid biosynthetic pathway. Tetrahydrofolic acid is essential for folate synthesis, a precursor of many nucleotides and amino acids. Many sulfamides are taken with trimethoprim, an inhibitor of dihydrofolate reductase, also disturbing the trihydrofolic acid synthesis pathway. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000387 UPDATED category_aro_cvterm_id with 36526 UPDATED category_aro_name with phenicol antibiotic UPDATED category_aro_description with Phenicols are broad spectrum bacteriostatic antibiotics acting on bacterial protein synthesis. More specifically, the phenicols block peptide elongation by binding to the peptidyltansferase centre of the 70S ribosome. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36590 " 1474 UPDATE MexR resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; macrolide antibiotic; fluoroquinolone antibiotic; monobactam; carbapenem; cephalosporin; penicillin beta-lactam; tetracycline antibiotic; peptide antibiotic; aminocoumarin antibiotic; diaminopyrimidine antibiotic; sulfonamide antibiotic; phenicol antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 0010004 UPDATED category_aro_cvterm_id with 36005 UPDATED category_aro_name with resistance-nodulation-cell division (RND) antibiotic efflux pump UPDATED category_aro_description with Directed pumping of antibiotic out of a cell to confer resistance. Resistance-nodulation-division (RND) proteins are found in both prokaryotic and eukaryotic cells and have diverse substrate specificities and physiological roles. However, there are relatively few RND transporters and they are secondary transporters, energized not by ATP binding/hydrolysis but by proton movement down the transmembrane electrochemical gradient. UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_accession with 0000000 UPDATED category_aro_cvterm_id with 35919 UPDATED category_aro_name with macrolide antibiotic UPDATED category_aro_description with Macrolides are a group of drugs (typically antibiotics) that have a large macrocyclic lactone ring of 12-16 carbons to which one or more deoxy sugars, usually cladinose and desosamine, may be attached. Macrolides bind to the 50S-subunit of bacterial ribosomes, inhibiting the synthesis of vital proteins. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 0000001 UPDATED category_aro_cvterm_id with 35920 UPDATED category_aro_name with fluoroquinolone antibiotic UPDATED category_aro_description with The fluoroquinolones are a family of synthetic broad-spectrum antibiotics that are 4-quinolone-3-carboxylates. These compounds interact with topoisomerase II (DNA gyrase) to disrupt bacterial DNA replication, damage DNA, and cause cell death. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 0000004 UPDATED category_aro_cvterm_id with 35923 UPDATED category_aro_name with monobactam UPDATED category_aro_description with Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 0000020 UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_name with carbapenem UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 0000032 UPDATED category_aro_cvterm_id with 35951 UPDATED category_aro_name with cephalosporin UPDATED category_aro_description with Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000008 UPDATED category_aro_cvterm_id with 36017 UPDATED category_aro_name with penicillin beta-lactam UPDATED category_aro_description with Penicilins (Penams) are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. Penicillin-like antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000050 UPDATED category_aro_cvterm_id with 36189 UPDATED category_aro_name with tetracycline antibiotic UPDATED category_aro_description with These antibiotics are derived from tetracycline, a polyketide antibiotic that inhibits the 30S subunit of bacterial ribosomes. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000103 UPDATED category_aro_cvterm_id with 36242 UPDATED category_aro_name with aminocoumarin antibiotic UPDATED category_aro_description with Aminocoumarin antibiotics bind DNA gyrase subunit B to inhibit ATP-dependent DNA supercoiling. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000171 UPDATED category_aro_cvterm_id with 36310 UPDATED category_aro_name with diaminopyrimidine antibiotic UPDATED category_aro_description with Diaminopyrimidines are a class of organic compounds containing a pyrimidine ring substituted by two amine groups. They are inhibitors of dihydrofolate reductase, an enzyme critical for DNA synthesis. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000282 UPDATED category_aro_cvterm_id with 36421 UPDATED category_aro_name with sulfonamide antibiotic UPDATED category_aro_description with Sulfonamides are broad spectrum, synthetic antibiotics that contain the sulfonamide group. Sulfonamides inhibit dihydropteroate synthase, which catalyzes the conversion of p-aminobenzoic acid to dihydropteroic acid as part of the tetrahydrofolic acid biosynthetic pathway. Tetrahydrofolic acid is essential for folate synthesis, a precursor of many nucleotides and amino acids. Many sulfamides are taken with trimethoprim, an inhibitor of dihydrofolate reductase, also disturbing the trihydrofolic acid synthesis pathway. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000387 UPDATED category_aro_cvterm_id with 36526 UPDATED category_aro_name with phenicol antibiotic UPDATED category_aro_description with Phenicols are broad spectrum bacteriostatic antibiotics acting on bacterial protein synthesis. More specifically, the phenicols block peptide elongation by binding to the peptidyltansferase centre of the 70S ribosome. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36590 " 3409 UPDATE OXA-123 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 1240 UPDATE mphL macrolide phosphotransferase (MPH); macrolide antibiotic; antibiotic inactivation; ARO_category "DELETED 35925 " 2688 UPDATE ArmR resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; macrolide antibiotic; fluoroquinolone antibiotic; monobactam; carbapenem; cephalosporin; penicillin beta-lactam; tetracycline antibiotic; peptide antibiotic; aminocoumarin antibiotic; diaminopyrimidine antibiotic; sulfonamide antibiotic; phenicol antibiotic; nonribosomal peptide antibiotics; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 0010004 UPDATED category_aro_cvterm_id with 36005 UPDATED category_aro_name with resistance-nodulation-cell division (RND) antibiotic efflux pump UPDATED category_aro_description with Directed pumping of antibiotic out of a cell to confer resistance. Resistance-nodulation-division (RND) proteins are found in both prokaryotic and eukaryotic cells and have diverse substrate specificities and physiological roles. However, there are relatively few RND transporters and they are secondary transporters, energized not by ATP binding/hydrolysis but by proton movement down the transmembrane electrochemical gradient. UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_accession with 0000000 UPDATED category_aro_cvterm_id with 35919 UPDATED category_aro_name with macrolide antibiotic UPDATED category_aro_description with Macrolides are a group of drugs (typically antibiotics) that have a large macrocyclic lactone ring of 12-16 carbons to which one or more deoxy sugars, usually cladinose and desosamine, may be attached. Macrolides bind to the 50S-subunit of bacterial ribosomes, inhibiting the synthesis of vital proteins. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 0000001 UPDATED category_aro_cvterm_id with 35920 UPDATED category_aro_name with fluoroquinolone antibiotic UPDATED category_aro_description with The fluoroquinolones are a family of synthetic broad-spectrum antibiotics that are 4-quinolone-3-carboxylates. These compounds interact with topoisomerase II (DNA gyrase) to disrupt bacterial DNA replication, damage DNA, and cause cell death. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 0000004 UPDATED category_aro_cvterm_id with 35923 UPDATED category_aro_name with monobactam UPDATED category_aro_description with Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 0000020 UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_name with carbapenem UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 0000032 UPDATED category_aro_cvterm_id with 35951 UPDATED category_aro_name with cephalosporin UPDATED category_aro_description with Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000008 UPDATED category_aro_cvterm_id with 36017 UPDATED category_aro_name with penicillin beta-lactam UPDATED category_aro_description with Penicilins (Penams) are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. Penicillin-like antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000050 UPDATED category_aro_cvterm_id with 36189 UPDATED category_aro_name with tetracycline antibiotic UPDATED category_aro_description with These antibiotics are derived from tetracycline, a polyketide antibiotic that inhibits the 30S subunit of bacterial ribosomes. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000103 UPDATED category_aro_cvterm_id with 36242 UPDATED category_aro_name with aminocoumarin antibiotic UPDATED category_aro_description with Aminocoumarin antibiotics bind DNA gyrase subunit B to inhibit ATP-dependent DNA supercoiling. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000171 UPDATED category_aro_cvterm_id with 36310 UPDATED category_aro_name with diaminopyrimidine antibiotic UPDATED category_aro_description with Diaminopyrimidines are a class of organic compounds containing a pyrimidine ring substituted by two amine groups. They are inhibitors of dihydrofolate reductase, an enzyme critical for DNA synthesis. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000282 UPDATED category_aro_cvterm_id with 36421 UPDATED category_aro_name with sulfonamide antibiotic UPDATED category_aro_description with Sulfonamides are broad spectrum, synthetic antibiotics that contain the sulfonamide group. Sulfonamides inhibit dihydropteroate synthase, which catalyzes the conversion of p-aminobenzoic acid to dihydropteroic acid as part of the tetrahydrofolic acid biosynthetic pathway. Tetrahydrofolic acid is essential for folate synthesis, a precursor of many nucleotides and amino acids. Many sulfamides are taken with trimethoprim, an inhibitor of dihydrofolate reductase, also disturbing the trihydrofolic acid synthesis pathway. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000387 UPDATED category_aro_cvterm_id with 36526 UPDATED category_aro_name with phenicol antibiotic UPDATED category_aro_description with Phenicols are broad spectrum bacteriostatic antibiotics acting on bacterial protein synthesis. More specifically, the phenicols block peptide elongation by binding to the peptidyltansferase centre of the 70S ribosome. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36590 " 3432 UPDATE OXA-265 OXA-214-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2689 UPDATE Staphylococcus aureus 23S rRNA with mutation conferring resistance to linezolid 23S rRNA with mutation conferring resistance to linezolid antibiotics; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; peptide antibiotic; oxazolidinone antibiotic; glycopeptide antibiotic; phenicol antibiotic; pleuromutilin antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35989 " 2691 UPDATE Type A NfxB resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; macrolide antibiotic; fluoroquinolone antibiotic; aminoglycoside antibiotic; cephalosporin; penicillin beta-lactam; tetracycline antibiotic; aminocoumarin antibiotic; diaminopyrimidine antibiotic; phenicol antibiotic; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_accession with 0000016 UPDATED category_aro_cvterm_id with 35935 UPDATED category_aro_name with aminoglycoside antibiotic UPDATED category_aro_description with Aminoglycosides are a group of antibiotics that are mostly effective against Gram-negative bacteria. These molecules consist of aminated sugars attached to a dibasic cyclitol. Aminoglycosides work by binding to the bacterial 30S ribosomal subunit (some work by binding to the 50S subunit), inhibiting the translocation of the peptidyl-tRNA from the A-site to the P-site and also causing misreading of mRNA, leaving the bacterium unable to synthesize proteins vital to its growth. UPDATED category_aro_class_name with Drug Class DELETED 35925 " 3462 UPDATE OXA-300 OXA-229-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2693 UPDATE Type B NfxB resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; macrolide antibiotic; fluoroquinolone antibiotic; aminoglycoside antibiotic; cephalosporin; penicillin beta-lactam; tetracycline antibiotic; aminocoumarin antibiotic; diaminopyrimidine antibiotic; phenicol antibiotic; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35925 " 3491 UPDATE OXA-406 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2697 UPDATE EdeQ Edeine acetyltransferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36269 " 3517 UPDATE OXA-448 OXA-184-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3547 UPDATE OXA-486 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2706 UPDATE MvaT resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; fluoroquinolone antibiotic; diaminopyrimidine antibiotic; phenicol antibiotic; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 36327 " 2707 UPDATE MexEF-OprN with MvaT deletion conferring resistance to chloramphenicol and norfloxacin resistance-nodulation-cell division (RND) antibiotic efflux pump; fluoroquinolone antibiotic; diaminopyrimidine antibiotic; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 36327 " 2267 UPDATE Escherichia coli nfsA mutations conferring resistance to nitrofurantoin antibiotic resistant nfsA; nitrofuran antibiotic; antibiotic target alteration; ARO_category "DELETED 35992 " 1897 UPDATE tet(L) major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 249 UPDATE basS pmr phosphoethanolamine transferase; antibiotic efflux regulatory protein; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36593 " 2291 UPDATE Chlamydia trachomatis intrinsic murA conferring resistance to fosfomycin antibiotic-resistant murA transferase; phosphonic acid antibiotic; antibiotic target alteration; ARO_category "DELETED 35944 " 2108 UPDATE Enterococcus faecium EF-Tu mutants conferring resistance to GE2270A elfamycin resistant EF-Tu; elfamycin antibiotic; antibiotic target alteration; ARO_category "DELETED 37636 " 1300 UPDATE MexF resistance-nodulation-cell division (RND) antibiotic efflux pump; fluoroquinolone antibiotic; diaminopyrimidine antibiotic; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 35954 " 624 UPDATE Mycobacterium leprae rpoB mutations conferring resistance to rifampicin rifamycin-resistant beta-subunit of RNA polymerase (rpoB); rifamycin antibiotic; antibiotic target alteration; antibiotic target replacement; ARO_category "DELETED 36308 " 1305 UPDATE OprM resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; fluoroquinolone antibiotic; monobactam; aminoglycoside antibiotic; carbapenem; cephalosporin; penicillin beta-lactam; tetracycline antibiotic; peptide antibiotic; aminocoumarin antibiotic; diaminopyrimidine antibiotic; sulfonamide antibiotic; phenicol antibiotic; disinfecting agents and antiseptics; nonribosomal peptide antibiotics; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 0000004 UPDATED category_aro_cvterm_id with 35923 UPDATED category_aro_name with monobactam UPDATED category_aro_description with Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000103 UPDATED category_aro_cvterm_id with 36242 UPDATED category_aro_name with aminocoumarin antibiotic UPDATED category_aro_description with Aminocoumarin antibiotics bind DNA gyrase subunit B to inhibit ATP-dependent DNA supercoiling. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000171 UPDATED category_aro_cvterm_id with 36310 UPDATED category_aro_name with diaminopyrimidine antibiotic UPDATED category_aro_description with Diaminopyrimidines are a class of organic compounds containing a pyrimidine ring substituted by two amine groups. They are inhibitors of dihydrofolate reductase, an enzyme critical for DNA synthesis. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000282 UPDATED category_aro_cvterm_id with 36421 UPDATED category_aro_name with sulfonamide antibiotic UPDATED category_aro_description with Sulfonamides are broad spectrum, synthetic antibiotics that contain the sulfonamide group. Sulfonamides inhibit dihydropteroate synthase, which catalyzes the conversion of p-aminobenzoic acid to dihydropteroic acid as part of the tetrahydrofolic acid biosynthetic pathway. Tetrahydrofolic acid is essential for folate synthesis, a precursor of many nucleotides and amino acids. Many sulfamides are taken with trimethoprim, an inhibitor of dihydrofolate reductase, also disturbing the trihydrofolic acid synthesis pathway. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35925 " 255 UPDATE BRP(MBL) Bleomycin resistant protein; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35970 " 2755 UPDATE ANT(3'')-IIc ANT(3''); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35957 " 2712 UPDATE MexXY-OprA resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; fluoroquinolone antibiotic; aminoglycoside antibiotic; carbapenem; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35925 " 2718 UPDATE MuxB resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; monobactam; tetracycline antibiotic; aminocoumarin antibiotic; antibiotic efflux; ARO_category "DELETED 35925 " 3410 UPDATE OXA-124 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3433 UPDATE OXA-266 OXA-266-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2720 UPDATE MuxC resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; monobactam; tetracycline antibiotic; aminocoumarin antibiotic; antibiotic efflux; ARO_category "DELETED 35925 " 3463 UPDATE OXA-301 OXA-229-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3492 UPDATE OXA-407 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3518 UPDATE OXA-449 OXA-184-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3522 UPDATE OXA-453 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3548 UPDATE OXA-488 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2724 UPDATE MuxABC-OpmB resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; monobactam; tetracycline antibiotic; aminocoumarin antibiotic; antibiotic efflux; ARO_category "DELETED 35925 " 3731 UPDATE Mycobacterium tuberculosis mymA mutations conferring resistance to isoniazid isoniazid resistant mymA; isoniazid-like antibiotic; antibiotic target alteration; model_param; ARO_category "UPDATED param_type with single resistance variant UPDATED param_description with A sequence change where, compared to a reference sequence, one amino acid is replaced by one other amino acid that is associated with elevated resistance to antibiotic(s) relative to wild type. Format is given as [wild-type][position][mutation], e.g. R184Q or R447Var where Var represents any possible substitution. UPDATED param_type_id with 36301 UPDATED 9575 with A205T DELETED 36659 " 2729 UPDATE MexJK-OprM resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35925 " 2731 UPDATE MexJK-OpmH resistance-nodulation-cell division (RND) antibiotic efflux pump; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 37250 " 2732 UPDATE MexVW-OprM resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; fluoroquinolone antibiotic; tetracycline antibiotic; phenicol antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 35925 " 2733 UPDATE TriABC-OpmH resistance-nodulation-cell division (RND) antibiotic efflux pump; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 37250 " 2734 UPDATE PmpM multidrug and toxic compound extrusion (MATE) transporter; fluoroquinolone antibiotic; aminoglycoside antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 35924 " 2745 UPDATE AcrAB-TolC resistance-nodulation-cell division (RND) antibiotic efflux pump; fluoroquinolone antibiotic; cephalosporin; glycylcycline; penicillin beta-lactam; tetracycline antibiotic; rifamycin antibiotic; phenicol antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 35949 " 2750 UPDATE APH(3')-VIIIb APH(3'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35932 " 2748 UPDATE oqxAB resistance-nodulation-cell division (RND) antibiotic efflux pump; fluoroquinolone antibiotic; glycylcycline; tetracycline antibiotic; diaminopyrimidine antibiotic; nitrofuran antibiotic; antibiotic efflux; ARO_category "DELETED 35949 " 2749 UPDATE lnuG lincosamide nucleotidyltransferase (LNU); lincosamide antibiotic; antibiotic inactivation; ARO_category "DELETED 35964 " 2752 UPDATE ANT(3'')-IIa ANT(3''); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35957 " 2754 UPDATE ANT(3'')-IIb ANT(3''); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35957 " 3411 UPDATE OXA-125 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2758 UPDATE LpeA resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; antibiotic efflux; ARO_category "DELETED 35925 " 2759 UPDATE LpeB resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; antibiotic efflux; ARO_category "DELETED 35925 " 2760 UPDATE MexGHI-OpmD resistance-nodulation-cell division (RND) antibiotic efflux pump; fluoroquinolone antibiotic; tetracycline antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 35963 " 2761 UPDATE MexPQ-OpmE resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; carbapenem; tetracycline antibiotic; diaminopyrimidine antibiotic; phenicol antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 35925 " 2762 UPDATE MexMN-OprM resistance-nodulation-cell division (RND) antibiotic efflux pump; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 36524 " 2763 UPDATE MdtABC-TolC resistance-nodulation-cell division (RND) antibiotic efflux pump; aminocoumarin antibiotic; antibiotic efflux; ARO_category "DELETED 36250 " 2765 UPDATE EmrAB-TolC major facilitator superfamily (MFS) antibiotic efflux pump; fluoroquinolone antibiotic; antibiotic efflux; ARO_category "DELETED 37005 " 2766 UPDATE EmrKY-TolC major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 3434 UPDATE OXA-267 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2768 UPDATE MdtEF-TolC resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; fluoroquinolone antibiotic; penicillin beta-lactam; antibiotic efflux; ARO_category "DELETED 35925 " 2769 UPDATE MdtNOP major facilitator superfamily (MFS) antibiotic efflux pump; nucleoside antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 35963 " 2770 UPDATE kamB 16S rRNA methyltransferase (A1408); aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35924 " 2771 UPDATE QepA2 major facilitator superfamily (MFS) antibiotic efflux pump; fluoroquinolone antibiotic; antibiotic efflux; ARO_category "DELETED 35954 " 3464 UPDATE OXA-302 OXA-286-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2773 UPDATE TMB-1 TMB beta-lactamase; carbapenem; cephalosporin; antibiotic inactivation; ARO_category "DELETED 35977 " 2774 UPDATE TMB-2 TMB beta-lactamase; carbapenem; cephalosporin; antibiotic inactivation; ARO_category "DELETED 35977 " 2775 UPDATE Pseudomonas aeruginosa soxR ATP-binding cassette (ABC) antibiotic efflux pump; major facilitator superfamily (MFS) antibiotic efflux pump; resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; fluoroquinolone antibiotic; cephalosporin; glycylcycline; penicillin beta-lactam; tetracycline antibiotic; rifamycin antibiotic; phenicol antibiotic; disinfecting agents and antiseptics; antibiotic target alteration; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35949 " 3493 UPDATE OXA-408 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2779 UPDATE FosA6 fosfomycin thiol transferase; phosphonic acid antibiotic; antibiotic inactivation; ARO_category "DELETED 35944 " 2780 UPDATE FosA7 fosfomycin thiol transferase; phosphonic acid antibiotic; antibiotic inactivation; ARO_category "DELETED 35944 " 2787 UPDATE Moraxella catarrhalis M35 General Bacterial Porin with reduced permeability to beta-lactams; monobactam; carbapenem; cephalosporin; penicillin beta-lactam; reduced permeability to antibiotic; resistance by absence; ARO_category "DELETED 35981 " 2781 UPDATE porin OmpC General Bacterial Porin with reduced permeability to beta-lactams; monobactam; carbapenem; cephalosporin; penicillin beta-lactam; reduced permeability to antibiotic; ARO_category "DELETED 35975 " 2782 UPDATE Vibrio cholerae OmpU General Bacterial Porin with reduced permeability to peptide antibiotics; peptide antibiotic; reduced permeability to antibiotic; ARO_category "DELETED 41245 " 3519 UPDATE OXA-450 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3523 UPDATE OXA-455 OXA-364-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2788 UPDATE Escherichia coli LamB Sugar Porin (SP); fluoroquinolone antibiotic; tetracycline antibiotic; reduced permeability to antibiotic; resistance by absence; ARO_category "DELETED 35954 " 2747 UPDATE AcrEF-TolC confers resistance to ciprofloxacin resistance-nodulation-cell division (RND) antibiotic efflux pump; fluoroquinolone antibiotic; cephalosporin; penicillin beta-lactam; antibiotic efflux; ARO_category "DELETED 35954 " 2786 UPDATE Burkholderia pseudomallei Omp38 General Bacterial Porin with reduced permeability to beta-lactams; monobactam; carbapenem; cephalosporin; penicillin beta-lactam; reduced permeability to antibiotic; ARO_category "DELETED 35927 " 2783 UPDATE Vibrio cholerae OmpT General Bacterial Porin with reduced permeability to peptide antibiotics; peptide antibiotic; reduced permeability to antibiotic; ARO_category "DELETED 41245 " 2790 UPDATE Serratia marcescens Omp1 General Bacterial Porin with reduced permeability to beta-lactams; fluoroquinolone antibiotic; monobactam; carbapenem; cephalosporin; penicillin beta-lactam; tetracycline antibiotic; phenicol antibiotic; reduced permeability to antibiotic; resistance by absence; ARO_category "DELETED 35927 " 2805 UPDATE Mycoplasma gallisepticum 23S rRNA mutation conferring resistance to pleuromutilin antibiotics 23S rRNA with mutation conferring resistance to pleuromutilin antibiotics; pleuromutilin antibiotic; antibiotic target alteration; ARO_category "DELETED 37716 " 2791 UPDATE Streptococcus mitis CdsA with mutation conferring daptomycin resistance daptomycin resistant CdsA; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35985 " 2833 UPDATE Brachyspira hyodysenteriae 23S rRNA with mutation conferring resistance to tylosin 23S rRNA with mutation conferring resistance to macrolide antibiotics; macrolide antibiotic; antibiotic target alteration; ARO_category "DELETED 36284 " 2792 UPDATE Moraxella catarrhalis 23S rRNA with mutation conferring resistance to macrolide antibiotics 23S rRNA with mutation conferring resistance to macrolide antibiotics; macrolide antibiotic; antibiotic target alteration; ARO_category "DELETED 35925 " 2794 UPDATE Helicobacter pylori 23S rRNA with mutation conferring resistance to clarithromycin 23S rRNA with mutation conferring resistance to macrolide antibiotics; macrolide antibiotic; antibiotic target alteration; ARO_category "DELETED 35982 " 2796 UPDATE OprZ resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; fluoroquinolone antibiotic; aminoglycoside antibiotic; cephalosporin; antibiotic efflux; ARO_category "DELETED 35925 " 2797 UPDATE AxyX resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; fluoroquinolone antibiotic; aminoglycoside antibiotic; cephalosporin; antibiotic efflux; ARO_category "DELETED 35925 " 2798 UPDATE AxyZ resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; macrolide antibiotic; fluoroquinolone antibiotic; aminoglycoside antibiotic; cephalosporin; antibiotic target alteration; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35925 " 2799 UPDATE AxyY resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; fluoroquinolone antibiotic; aminoglycoside antibiotic; cephalosporin; antibiotic efflux; ARO_category "DELETED 35925 " 2800 UPDATE cfrC Cfr-like 23S rRNA methyltransferase; lincosamide antibiotic; streptogramin antibiotic; oxazolidinone antibiotic; phenicol antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Cfr-like 23S rRNA methyltransferase DELETED 36524 " 2806 UPDATE Escherichia coli 23S rRNA with mutation conferring resistance to clindamycin 23S rRNA with mutation conferring resistance to lincosamide antibiotics; lincosamide antibiotic; antibiotic target alteration; ARO_category "DELETED 35983 " 2807 UPDATE Escherichia coli 23S rRNA with mutation conferring resistance to clarithromycin 23S rRNA with mutation conferring resistance to macrolide antibiotics; macrolide antibiotic; antibiotic target alteration; ARO_category "DELETED 35982 " 2808 UPDATE Propionibacteria 23S rRNA with mutation conferring resistance to macrolide antibiotics 23S rRNA with mutation conferring resistance to macrolide antibiotics; macrolide antibiotic; antibiotic target alteration; ARO_category "DELETED 35925 " 2803 UPDATE Mycobacterium tuberculosis thyA with mutation conferring resistance to para-aminosalicylic acid aminosalicylate resistant thymidylate synthase; salicylic acid antibiotic; antibiotic target alteration; ARO_category "DELETED 40948 " 2804 UPDATE Mycobacterium tuberculosis folC with mutation conferring resistance to para-aminosalicylic acid aminosalicylate resistant dihydrofolate synthase; salicylic acid antibiotic; antibiotic target alteration; ARO_category "DELETED 40948 " 2816 UPDATE Mycolicibacterium smegmatis 23S rRNA with mutation conferring resistance to clarithromycin 23S rRNA with mutation conferring resistance to macrolide antibiotics; macrolide antibiotic; antibiotic target alteration; ARO_category "DELETED 35982 " 2811 UPDATE Mycobacterium avium 23S rRNA with mutation conferring resistance to clarithromycin 23S rRNA with mutation conferring resistance to macrolide antibiotics; macrolide antibiotic; antibiotic target alteration; ARO_category "DELETED 35982 " 2813 UPDATE Mycobacterium intracellulare 23S rRNA with mutation conferring resistance to clarithromycin 23S rRNA with mutation conferring resistance to macrolide antibiotics; macrolide antibiotic; antibiotic target alteration; ARO_category "DELETED 35982 " 2814 UPDATE Mycobacterium intracellulare 23S rRNA with mutation conferring resistance to azithromycin 23S rRNA with mutation conferring resistance to macrolide antibiotics; macrolide antibiotic; antibiotic target alteration; ARO_category "DELETED 36297 " 2815 UPDATE Mycobacterium kansasii 23S rRNA with mutation conferring resistance to clarithromycin 23S rRNA with mutation conferring resistance to macrolide antibiotics; macrolide antibiotic; antibiotic target alteration; ARO_category "DELETED 35982 " 2793 UPDATE Chlamydomonas reinhardtii 23S rRNA with mutation conferring resistance to erythromycin 23S rRNA with mutation conferring resistance to macrolide antibiotics; macrolide antibiotic; antibiotic target alteration; ARO_category "DELETED 35925 " 2802 UPDATE Escherichia coli 23S rRNA with mutation conferring resistance to erythromycin and telithromycin 23S rRNA with mutation conferring resistance to macrolide antibiotics; macrolide antibiotic; antibiotic target alteration; ARO_category "DELETED 35925 " 2810 UPDATE Mycobacteroides abscessus 23S rRNA with mutation conferring resistance to clarithromycin 23S rRNA with mutation conferring resistance to macrolide antibiotics; macrolide antibiotic; antibiotic target alteration; ARO_category "DELETED 35982 " 2817 UPDATE Streptococcus pneumoniae 23S rRNA with mutation conferring resistance to macrolide antibiotics 23S rRNA with mutation conferring resistance to macrolide antibiotics; macrolide antibiotic; antibiotic target alteration; ARO_category "DELETED 35925 " 2819 UPDATE Escherichia coli 23S rRNA with mutation conferring resistance to oxazolidinone antibiotics 23S rRNA with mutation conferring resistance to oxazolidinone antibiotics; oxazolidinone antibiotic; antibiotic target alteration; ARO_category "DELETED 35989 " 2820 UPDATE Chlamydia trachomatis 23S rRNA with mutation conferring resistance to macrolide antibiotics 23S rRNA with mutation conferring resistance to macrolide antibiotics; macrolide antibiotic; antibiotic target alteration; ARO_category "DELETED 35925 " 3412 UPDATE OXA-126 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2824 UPDATE Mycoplasma pneumoniae 23S rRNA mutation conferring resistance to erythromycin 23S rRNA with mutation conferring resistance to macrolide antibiotics; macrolide antibiotic; antibiotic target alteration; model_sequences; ARO_category "UPDATED NCBI_taxonomy_name with Mycoplasmoides pneumoniae DELETED 35925 " 2825 UPDATE Halobacterium halobium 23S rRNA mutation conferring resistance to chloramphenicol 23S rRNA with mutation conferring resistance to phenicol antibiotics; phenicol antibiotic; antibiotic target alteration; ARO_category "DELETED 36524 " 2826 UPDATE Streptococcus pneumoniae 23S rRNA mutation conferring resistance to macrolides and streptogramins antibiotics 23S rRNA with mutation conferring resistance to macrolide antibiotics; 23S rRNA with mutation conferring resistance to streptogramins antibiotics; macrolide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "DELETED 36284 " 2827 UPDATE Mycobacterium tuberculosis ribD with mutation conferring resistance to para-aminosalicylic acid aminosalicylate resistant dihydrofolate reductase; salicylic acid antibiotic; antibiotic target replacement; model_param; ARO_category "UPDATED param_type with single resistance variant UPDATED param_description with A sequence change where, compared to a reference sequence, one amino acid is replaced by one other amino acid that is associated with elevated resistance to antibiotic(s) relative to wild type. Format is given as [wild-type][position][mutation], e.g. R184Q or R447Var where Var represents any possible substitution. UPDATED param_type_id with 36301 UPDATED 8013 with G8R DELETED 40948 " 2828 UPDATE mecD PBP2-like beta-lactam resistant peptidoglycan transpeptidase; penicillin beta-lactam; antibiotic target replacement; model_sequences; ARO_category "UPDATED accession with WP_087587946.1 UPDATED sequence with MKNIKVKILIVCSLCLISFFLYNLLKENEIDKIFSSIENRNVDEINENITFLSRNTFSKKQRYDRMNHIDNSLGIKKVNITDIKLLEEIVDTRKYSANMHYDSKFGKFTKKGYFEFEKNGESKRWELNWTPEVIIPGLTATNEVRVEELKSSRGEIVDRNGIPLAIDGEHYQVGIDPKNYNKKDSKQIAKLLNINESTLKNKLKQSWVKDGVFVPIKSYVELSDEIKNKIPEYGLSVNKIKGRTYPLKEASAHLLGYIGEINADELNDPKFKGYDSHSIVGKTGIEYMYDKELQNRDGLIVYITDDDGLTDSKEILVHKKPKNGKKIVLSIDSRVQNSIYNHLKDDNGSGTAMNPKTGELLALVSYPSFNPYDFMFGISNKKYQALLNDKKAPLLNKFQELTSPGSTQKLLTSIIGLNNGVINESKSYEINGKGWRKDGSWGGYKVTRFEVVNGRIDLEKAIAHSDNIFFARTTLEMGGKKFVRGMKDLGVGEETPSDYPVRTGQIANKINLERNLNNDILLADSGYGQGEILVNPIHILSIYSSLVNEGNMMAPKLNMEHKSKVWKKHITSQKNIDILTSSMRKVVTGTHKLDTERNYANFAGKTGTAELKMTQNEGLGTQIGWFVGYDQQNPNMMLAINVKNVEDKGMSSYNAQKFAQVMDDLYEHGARTYEPDSE UPDATED accession with NG_054960.1 UPDATED fmin with 100 UPDATED fmax with 2137 UPDATED strand with + UPDATED sequence with ATGAAGAATATAAAAGTTAAAATATTAATAGTTTGTAGCCTATGTCTTATATCATTTTTCTTATATAATTTATTGAAAGAAAATGAAATTGATAAAATATTTTCTTCAATTGAAAATCGAAATGTAGATGAAATAAATGAGAATATTACTTTTTTATCAAGAAATACTTTTAGTAAAAAACAAAGATACGATAGAATGAATCATATTGATAATTCTCTAGGCATAAAAAAAGTAAATATAACTGATATAAAGTTATTAGAAGAAATTGTAGACACTCGAAAATATAGTGCTAATATGCACTATGATTCTAAATTCGGTAAATTCACAAAAAAAGGTTATTTTGAGTTTGAAAAAAATGGTGAGAGTAAACGTTGGGAATTGAACTGGACACCAGAGGTTATAATTCCAGGACTTACAGCAACTAATGAAGTACGAGTAGAAGAATTGAAATCAAGTAGAGGTGAAATTGTAGATAGAAATGGAATTCCTTTAGCGATAGATGGTGAACATTATCAGGTAGGAATTGATCCTAAAAATTATAATAAGAAGGATAGTAAACAAATAGCTAAGTTATTAAATATAAATGAGAGTACTTTAAAGAACAAATTAAAACAATCATGGGTTAAAGATGGAGTATTTGTTCCAATCAAATCATATGTAGAATTAAGTGATGAAATTAAAAATAAAATACCTGAATACGGATTATCTGTGAATAAAATAAAAGGTAGAACTTACCCATTAAAAGAAGCAAGTGCTCATTTGTTAGGTTATATTGGTGAAATAAATGCAGATGAGCTTAATGATCCAAAATTTAAAGGATATGATTCTCATTCAATTGTTGGTAAAACTGGTATTGAATATATGTACGATAAAGAATTACAAAACAGAGATGGTTTAATAGTATATATTACTGATGATGATGGTTTAACAGATTCAAAAGAAATATTAGTTCATAAGAAACCTAAAAATGGAAAAAAGATAGTTTTATCGATAGATAGTAGAGTTCAAAATAGTATTTACAATCATTTAAAAGATGATAATGGATCTGGTACTGCTATGAATCCCAAAACAGGAGAATTATTAGCTTTAGTAAGCTATCCATCATTTAATCCTTATGATTTTATGTTTGGTATTTCAAATAAAAAATATCAGGCCTTATTAAATGATAAAAAGGCTCCGCTTTTAAATAAATTTCAAGAATTAACTTCTCCAGGTTCTACTCAAAAATTGCTAACTTCTATAATAGGTTTAAATAATGGGGTTATAAATGAAAGCAAAAGTTATGAAATAAATGGTAAAGGATGGAGAAAAGATGGGAGCTGGGGAGGATATAAAGTAACAAGATTTGAAGTTGTCAATGGACGAATTGATTTAGAGAAAGCTATAGCACATTCAGACAATATCTTTTTTGCTAGAACAACCCTAGAAATGGGTGGGAAAAAATTTGTAAGGGGAATGAAGGATTTAGGTGTAGGAGAGGAAACGCCTTCTGATTACCCTGTTCGGACTGGCCAAATAGCGAATAAAATTAATCTAGAAAGAAATTTGAATAATGATATATTGTTAGCAGACTCAGGTTATGGACAAGGTGAAATATTGGTGAATCCAATTCATATTTTATCTATATATAGTTCATTAGTAAATGAAGGGAATATGATGGCACCTAAATTAAATATGGAACATAAAAGCAAAGTATGGAAAAAACATATTACATCACAAAAAAATATTGATATATTAACAAGTAGTATGAGAAAAGTTGTTACAGGCACTCATAAATTAGATACCGAAAGAAATTATGCTAACTTTGCTGGAAAAACTGGTACAGCAGAATTAAAAATGACTCAGAATGAAGGATTAGGTACACAAATTGGATGGTTTGTGGGTTATGATCAACAAAATCCAAATATGATGTTAGCTATAAATGTTAAAAATGTTGAAGACAAAGGTATGTCTAGCTATAATGCACAAAAATTTGCGCAAGTAATGGATGATTTATATGAACATGGAGCTAGGACTTATGAACCAGACTCAGAATAA UPDATED partial with 0 UPDATED NCBI_taxonomy_cvterm_id with 40025 UPDATED NCBI_taxonomy_name with Macrococcus caseolyticus UPDATED NCBI_taxonomy_id with 69966 DELETED 4173 UPDATED category_aro_accession with 3009312 UPDATED category_aro_cvterm_id with 48160 UPDATED category_aro_name with PBP2-like beta-lactam resistant peptidoglycan transpeptidase UPDATED category_aro_description with Peptidoglycan transpeptidase proteins involved in bacterial cell wall formation and which have decreased susceptibility to some beta-lactam antibiotics. These alternative transpeptidases are found in certain organisms, like Staphylococcus aureus, and have lower affinity for penicillin-like antibiotics, such as methicillin. In these organisms, these proteins do not bind to the beta-lactam ring and therefore transpeptidase activity continues in the presence of beta-lactams, thereby conferring resistance to these drugs. These proteins are commonly clinically associated with methicillin-resistant Staphylococcus aureus (MRSA). UPDATED category_aro_class_name with AMR Gene Family DELETED 37589 " 37 UPDATE Escherichia coli mdfA major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline antibiotic; phenicol antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 35968 " 328 UPDATE Salmonella enterica cmlA major facilitator superfamily (MFS) antibiotic efflux pump; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 36524 " 2704 UPDATE MexEF-OprN with MexT mutation conferring resistance to chloramphenicol, ciprofloxacin, and trimethoprim resistance-nodulation-cell division (RND) antibiotic efflux pump; fluoroquinolone antibiotic; diaminopyrimidine antibiotic; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 35954 " 2832 UPDATE AAC(2')-Ie AAC(2'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 2834 UPDATE Mycobacterium tuberculosis iniB with mutation conferring resistance to ethambutol Ethambutol resistant iniB; polyamine antibiotic; antibiotic target alteration; antibiotic efflux; model_param; ARO_category "UPDATED param_type with single resistance variant UPDATED param_description with A sequence change where, compared to a reference sequence, one amino acid is replaced by one other amino acid that is associated with elevated resistance to antibiotic(s) relative to wild type. Format is given as [wild-type][position][mutation], e.g. R184Q or R447Var where Var represents any possible substitution. UPDATED param_type_id with 36301 UPDATED 8201 with A47T DELETED 36636 " 2835 UPDATE PatA-PatB ATP-binding cassette (ABC) antibiotic efflux pump; fluoroquinolone antibiotic; antibiotic efflux; ARO_category "DELETED 35954 " 2837 UPDATE APH(2'')-If APH(2''); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 2838 UPDATE MCR-1.2 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 2841 UPDATE Escherichia coli 23S rRNA with mutation conferring resistance to chloramphenicol 23S rRNA with mutation conferring resistance to phenicol antibiotics; phenicol antibiotic; antibiotic target alteration; ARO_category "DELETED 36524 " 2842 UPDATE Vibrio cholerae varG Subclass B1 Vibrio cholerae varG beta-lactamase; carbapenem; antibiotic inactivation; ARO_category "DELETED 35990 " 3621 UPDATE LAP-2 LAP beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35976 " 2844 UPDATE Rhodobacter sphaeroides ampC beta-lactamase ampC-type beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36976 " 2822 UPDATE Mycoplasma hominis 23S rRNA with mutation conferring resistance to macrolide antibiotics 23S rRNA with mutation conferring resistance to macrolide antibiotics; macrolide antibiotic; antibiotic target alteration; ARO_category "DELETED 35925 " 2831 UPDATE rpoB2 rifamycin-resistant beta-subunit of RNA polymerase (rpoB); rifamycin antibiotic; antibiotic target alteration; antibiotic target replacement; ARO_category "DELETED 36308 " 2377 UPDATE Escherichia coli PtsI with mutation conferring resistance to fosfomycin antibiotic-resistant ptsI phosphotransferase; phosphonic acid antibiotic; antibiotic target alteration; ARO_category "DELETED 35944 " 2850 UPDATE Salmonella enterica gyrA with mutation conferring resistance to triclosan triclosan resistant gyrA; disinfecting agents and antiseptics; antibiotic target alteration; ARO_category "DELETED 37250 " 2851 UPDATE Escherichia coli gyrA with mutation conferring resistance to triclosan triclosan resistant gyrA; disinfecting agents and antiseptics; antibiotic target alteration; ARO_category "DELETED 37250 " 2873 UPDATE catV chloramphenicol acetyltransferase (CAT); phenicol antibiotic; antibiotic inactivation; ARO_category "DELETED 36524 " 2874 UPDATE ACI-1 ACI beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 2875 UPDATE sul4 sulfonamide resistant sul; sulfonamide antibiotic; antibiotic target replacement; ARO_category "DELETED 36468 " 2876 UPDATE OXA-436 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2877 UPDATE OXA-535 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2878 UPDATE almG lipid A acyltransferase; polymyxin resistance operon; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 3413 UPDATE OXA-127 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3435 UPDATE OXA-268 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2880 UPDATE QepA4 major facilitator superfamily (MFS) antibiotic efflux pump; fluoroquinolone antibiotic; antibiotic efflux; ARO_category "DELETED 35954 " 2881 UPDATE tet(59) major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 2882 UPDATE tet(W/N/W) tetracycline-resistant ribosomal protection protein; tetracycline antibiotic; antibiotic target protection; ARO_category "DELETED 35968 " 2886 UPDATE Haemophilus influenzae PBP3 conferring resistance to beta-lactam antibiotics penicillin-binding protein with mutation conferring resistance to beta-lactam antibiotics; monobactam; cephalosporin; penicillin beta-lactam; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 0000004 UPDATED category_aro_cvterm_id with 35923 UPDATED category_aro_name with monobactam UPDATED category_aro_description with Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_name with penicillin-binding protein with mutation conferring resistance to beta-lactam antibiotics DELETED 35979 " 3436 UPDATE OXA-269 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2889 UPDATE TRU-1 TRU beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 37084 " 2890 UPDATE Agrobacterium fabrum chloramphenicol acetyltransferase chloramphenicol acetyltransferase (CAT); phenicol antibiotic; antibiotic inactivation; ARO_category "DELETED 36524 " 2893 UPDATE Campylobacter coli chloramphenicol acetyltransferase chloramphenicol acetyltransferase (CAT); phenicol antibiotic; antibiotic inactivation; ARO_category "DELETED 36524 " 2894 UPDATE Streptococcus suis chloramphenicol acetyltransferase chloramphenicol acetyltransferase (CAT); phenicol antibiotic; antibiotic inactivation; ARO_category "DELETED 36524 " 2895 UPDATE Enterococcus faecium chloramphenicol acetyltransferase chloramphenicol acetyltransferase (CAT); phenicol antibiotic; antibiotic inactivation; ARO_category "DELETED 36524 " 2896 UPDATE Staphylococcus intermedius chloramphenicol acetyltransferase chloramphenicol acetyltransferase (CAT); phenicol antibiotic; antibiotic inactivation; ARO_category "DELETED 36524 " 2897 UPDATE Enterococcus faecalis chloramphenicol acetyltransferase chloramphenicol acetyltransferase (CAT); phenicol antibiotic; antibiotic inactivation; ARO_category "DELETED 36524 " 2899 UPDATE Vibrio anguillarum chloramphenicol acetyltransferase chloramphenicol acetyltransferase (CAT); phenicol antibiotic; antibiotic inactivation; ARO_category "DELETED 36524 " 1042 UPDATE Pseudomonas aeruginosa catB7 chloramphenicol acetyltransferase (CAT); phenicol antibiotic; antibiotic inactivation; ARO_category "DELETED 36521 " 2902 UPDATE ICR-Mc intrinsic colistin resistant phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 2904 UPDATE poxtA Miscellaneous ABC-F subfamily ATP-binding cassette ribosomal protection proteins; tetracycline antibiotic; oxazolidinone antibiotic; phenicol antibiotic; antibiotic target protection; ARO_category "DELETED 35968 " 3465 UPDATE OXA-303 OXA-286-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3494 UPDATE OXA-409 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3520 UPDATE OXA-451 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3524 UPDATE OXA-457 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 3707 UPDATE Mycobacterium tuberculosis eis mutations confer resistance to kanamycin kanamycin-resistant eis; aminoglycoside antibiotic; antibiotic target alteration; model_name; model_param; ARO_name; ARO_category "UPDATED model_name with Mycobacterium tuberculosis eis with mutation conferring resistance to kanamycin UPDATED 13328 with V163I UPDATED 13284 with A516T UPDATED 15412 with V163I UPDATED 15413 with V163I UPDATED 15414 with V163I UPDATED 15415 with V163I UPDATED ARO_name with Mycobacterium tuberculosis eis with mutation conferring resistance to kanamycin UPDATED category_aro_name with kanamycin-resistant eis DELETED 35966 " 3701 UPDATE Neisseria gonorrhoeae folP with mutation conferring resistance to sulfonamides sulfonamide resistant dihydropteroate synthase folP; sulfonamide antibiotic; antibiotic target alteration; model_sequences; ARO_category "UPDATED accession with EEH62517.1 UPDATED sequence with MARHVWRAGRFEIGLDKPKIMGIVNLTPDSFSDGGAYSQNAQTALAHAERLLKEGADILDIGGESTRPGADFVPPEEEWARVEPVLAEAAGWGVPVSLDTRRTVVMEKALALGGIDIINDVAALTDEGAVELLARQADTGICLMHMRGLPETMQDNPKYQDVVGEVARYLKTRSETCVAAGIAPQRITLDPGFGFGKNLQHNIALMRHLPELMAETGLPLLIGVSRKRMIGELTGEADAAARVHGSVAAALASVARGAQIVRVHDVKATADALKVWEALGVNR UPDATED accession with DS999940.1 UPDATED fmin with 37719 UPDATED fmax with 38571 UPDATED strand with - UPDATED sequence with ATGGCACGACACGTTTGGCGGGCAGGACGGTTTGAAATCGGTTTGGACAAACCGAAAATCATGGGCATCGTGAATCTCACGCCCGATTCTTTTTCCGACGGCGGCGCGTATTCGCAAAACGCCCAAACAGCTTTGGCGCATGCCGAACGGCTTTTGAAAGAGGGTGCGGACATTCTCGACATCGGCGGCGAATCGACGCGGCCGGGTGCGGATTTCGTTCCGCCCGAAGAAGAATGGGCGCGGGTTGAGCCTGTATTGGCGGAAGCGGCGGGGTGGGGCGTTCCCGTCAGTTTGGACACGCGCCGCACGGTGGTTATGGAAAAGGCGTTGGCACTCGGCGGCATCGATATTATCAATGATGTGGCGGCGTTGACCGACGAAGGTGCGGTCGAATTGCTGGCGCGCCAGGCGGACACGGGCATTTGCCTGATGCATATGCGGGGCTTGCCCGAAACCATGCAGGACAATCCGAAATATCAGGATGTGGTCGGCGAAGTGGCACGTTATCTGAAAACACGGTCAGAAACCTGTGTCGCGGCAGGCATCGCGCCGCAACGGATTACGCTCGACCCGGGTTTCGGCTTCGGCAAGAACCTGCAACACAATATCGCACTGATGCGGCATTTGCCCGAATTGATGGCGGAAACCGGTTTGCCGCTGCTGATCGGTGTGTCGCGCAAACGCATGATAGGTGAGCTGACCGGTGAGGCGGACGCGGCGGCGCGCGTACACGGCAGCGTGGCAGCGGCTTTGGCTTCCGTGGCACGCGGAGCGCAAATCGTGCGCGTGCACGATGTGAAGGCGACGGCGGACGCGTTGAAGGTGTGGGAAGCGTTGGGCGTGAACCGGTAA UPDATED partial with 0 UPDATED NCBI_taxonomy_cvterm_id with 48511 UPDATED NCBI_taxonomy_name with Neisseria gonorrhoeae 1291 UPDATED NCBI_taxonomy_id with 528345 DELETED 5974 DELETED 36469 " 3702 UPDATE Mycobacterium tuberculosis inhA mutations conferring resistance to ethionamide inhA with mutations with conferring resistance to ethionamide; thioamide antibiotic; antibiotic target alteration; ARO_category "DELETED 40067 " 3703 UPDATE Mycobacterium tuberculosis nudC mutations conferring resistance to isoniazid isoniazid resistant nudC; isoniazid-like antibiotic; antibiotic target alteration; ARO_category "DELETED 36659 " 3415 UPDATE OXA-151 OXA-62-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3437 UPDATE OXA-270 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3466 UPDATE OXA-304 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3495 UPDATE OXA-411 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3521 UPDATE OXA-452 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3525 UPDATE OXA-458 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 3416 UPDATE OXA-152 OXA-62-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3438 UPDATE OXA-271 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3467 UPDATE OXA-305 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3496 UPDATE OXA-412 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3526 UPDATE OXA-459 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 3620 UPDATE LAP-1 LAP beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35976 " 3417 UPDATE OXA-153 OXA-62-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3439 UPDATE OXA-272 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3468 UPDATE OXA-306 OXA-286-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3497 UPDATE OXA-413 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3527 UPDATE OXA-460 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3706 UPDATE Mycobacterium tuberculosis ponA1 mutations conferring resistance to rifabutin rifamycin resistant ponA1; rifamycin antibiotic; antibiotic target alteration; model_param; ARO_category "UPDATED 9759 with G363D DELETED 36308 " 3734 UPDATE Mycobacterium tuberculosis nat mutations conferring resistance to isoniazid isoniazid resistant nat; isoniazid-like antibiotic; antibiotic target alteration; model_param; ARO_category "UPDATED 9578 with V163I UPDATED 18569 with V163I DELETED 36659 " 3418 UPDATE OXA-154 OXA-62-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3440 UPDATE OXA-273 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3498 UPDATE OXA-414 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3528 UPDATE OXA-461 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3617 UPDATE IMI-8 IMI beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 0000032 UPDATED category_aro_cvterm_id with 35951 UPDATED category_aro_name with cephalosporin UPDATED category_aro_description with Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000008 UPDATED category_aro_cvterm_id with 36017 UPDATED category_aro_name with penicillin beta-lactam UPDATED category_aro_description with Penicilins (Penams) are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. Penicillin-like antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_class_name with Drug Class " 3419 UPDATE OXA-155 OXA-62-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3441 UPDATE OXA-275 OXA-274-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3470 UPDATE OXA-308 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 3499 UPDATE OXA-416 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3529 UPDATE OXA-464 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 3420 UPDATE OXA-156 OXA-62-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3442 UPDATE OXA-276 OXA-134-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3471 UPDATE OXA-336 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3503 UPDATE OXA-430 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3216 UPDATE mphH macrolide phosphotransferase (MPH); macrolide antibiotic; antibiotic inactivation; ARO_category "DELETED 36297 " 3500 UPDATE OXA-417 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3530 UPDATE OXA-465 OXA-184-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3652 UPDATE CMY-136 CMY beta-lactamase; cephalosporin; antibiotic inactivation; ARO_category "DELETED 35980 " 3994 UPDATE TEM-231 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 2907 UPDATE vmlR Miscellaneous ABC-F subfamily ATP-binding cassette ribosomal protection proteins; lincosamide antibiotic; streptogramin antibiotic; antibiotic without defined classification; nucleoside antibiotic; pleuromutilin antibiotic; antibiotic target protection; ARO_category "DELETED 35964 " 2909 UPDATE OXA-664 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 2910 UPDATE OXA-665 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 3421 UPDATE OXA-157 OXA-62-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2912 UPDATE OXA-274 OXA-274-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2913 UPDATE OXA-286 OXA-286-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3443 UPDATE OXA-277 OXA-134-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3472 UPDATE OXA-337 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2960 UPDATE OXA-663 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3501 UPDATE OXA-427 OXA-427-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3531 UPDATE OXA-466 OXA-184-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3422 UPDATE OXA-158 OXA-62-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3654 UPDATE Neisseria gonorrhoeae gyrB conferring resistance to zoliflodacin Zoliflodacin resistant gyrB; zoliflodacin-like antibiotic; antibiotic target alteration; ARO_category "DELETED 42994 " 3444 UPDATE OXA-279 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 3473 UPDATE OXA-339 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3502 UPDATE OXA-429 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3532 UPDATE OXA-470 OXA-63-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2397 UPDATE pgpB lipid A phosphatase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36593 " 3628 UPDATE Neisseria gonorrhoeae PBP2 conferring resistance to beta-lactam antibiotics penicillin-binding protein with mutation conferring resistance to beta-lactam antibiotics; monobactam; cephalosporin; penicillin beta-lactam; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 0000004 UPDATED category_aro_cvterm_id with 35923 UPDATED category_aro_name with monobactam UPDATED category_aro_description with Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_name with penicillin-binding protein with mutation conferring resistance to beta-lactam antibiotics DELETED 35979 " 3633 UPDATE OXA-724 OXA-12-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3656 UPDATE Burkholderia dolosa gyrA conferring resistance to fluoroquinolones fluoroquinolone resistant gyrA; fluoroquinolone antibiotic; nybomycin-like antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3007157 UPDATED category_aro_cvterm_id with 45739 UPDATED category_aro_name with nybomycin-like antibiotic UPDATED category_aro_description with A group of antibiotics including nybomycin and its derivatives. UPDATED category_aro_class_name with Drug Class DELETED 35954 " 3708 UPDATE Mycobacterium tuberculosis whib7 mutations confer resistance to kanamycin Kanamycin resistant whib7; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35966 " 3735 UPDATE Mycobacterium tuberculosis sigI mutations conferring resistance to isoniazid isoniazid resistant sigI; isoniazid-like antibiotic; antibiotic target alteration; ARO_category "DELETED 36659 " 3423 UPDATE OXA-185 OXA-184-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3445 UPDATE OXA-280 OXA-211-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3474 UPDATE OXA-340 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3533 UPDATE OXA-471 OXA-63-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3217 UPDATE mphK macrolide phosphotransferase (MPH); macrolide antibiotic; antibiotic inactivation; ARO_category "DELETED 35974 " 2785 UPDATE Klebsiella pneumoniae OmpK37 General Bacterial Porin with reduced permeability to beta-lactams; monobactam; carbapenem; cephalosporin; penicillin beta-lactam; reduced permeability to antibiotic; ARO_category "DELETED 35927 " 3651 UPDATE Mycobacterium tuberculosis 16S rRNA mutation conferring resistance to capreomycin 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 40875 " 3653 UPDATE SCO-1 SCO beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35976 " 3995 UPDATE TEM-232 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 3629 UPDATE Neisseria gonorrhoeae PBP1 conferring resistance to beta-lactam antibiotics penicillin-binding protein with mutation conferring resistance to beta-lactam antibiotics; monobactam; cephalosporin; penicillin beta-lactam; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 0000004 UPDATED category_aro_cvterm_id with 35923 UPDATED category_aro_name with monobactam UPDATED category_aro_description with Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_name with penicillin-binding protein with mutation conferring resistance to beta-lactam antibiotics " 3329 UPDATE Mycoplasma genitalium parC mutations confers resistance to Moxifloxacin fluoroquinolone resistant parC; fluoroquinolone antibiotic; antibiotic target alteration; model_sequences; ARO_category "UPDATED NCBI_taxonomy_name with Mycoplasmoides genitalium DELETED 35991 " 3646 UPDATE Neisseria gonorrhoeae 23S rRNA with mutation conferring resistance to azithromycin 23S rRNA with mutation conferring resistance to macrolide antibiotics; macrolide antibiotic; antibiotic target alteration; ARO_category "DELETED 36297 " 3649 UPDATE Neisseria gonorrhoeae mtrR with mutation conferring resistance resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; macrolide antibiotic; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35925 " 3631 UPDATE Neisseria gonorrhoeae pilQ gene conferring resistance to beta-lactam penicillin-binding protein with mutation conferring resistance to beta-lactam antibiotics; monobactam; cephalosporin; penicillin beta-lactam; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 0000004 UPDATED category_aro_cvterm_id with 35923 UPDATED category_aro_name with monobactam UPDATED category_aro_description with Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_name with penicillin-binding protein with mutation conferring resistance to beta-lactam antibiotics DELETED 35979 " 3709 UPDATE Mycobacterium tuberculosis whib7 mutation conferring resistance to streptomycin streptomycin resistant whib7; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35958 " 3736 UPDATE Mycobacterium tuberculosis Rv0565c mutation conferring resistance to ethionamide Ethionamide resistant Rv0565c; thioamide antibiotic; antibiotic target alteration; ARO_category "DELETED 40067 " 3424 UPDATE OXA-234 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3446 UPDATE OXA-281 OXA-211-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3475 UPDATE OXA-341 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3504 UPDATE OXA-431 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3534 UPDATE OXA-472 OXA-63-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3742 UPDATE Mycobacterium tuberculosis ddlA mutations confer resistance to cycloserine cycloserine resistant ddlA; cycloserine-like antibiotic; antibiotic target alteration; ARO_category "DELETED 37140 " 3746 UPDATE Mycobacterium tuberculosis rpoC mutations confer resistance to rifampicin rifampicin resistant rpoC; rifamycin antibiotic; antibiotic target alteration; model_param; ARO_category "UPDATED 9820 with N416S DELETED 36308 " 3747 UPDATE Mycobacterium tuberculosis rpoA mutations confer resistance to rifampicin rifampicin resistant rpoA; rifamycin antibiotic; antibiotic target alteration; ARO_category "DELETED 36308 " 3425 UPDATE OXA-252 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3447 UPDATE OXA-282 OXA-134-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3476 UPDATE OXA-342 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3076 UPDATE dfrB4 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 3505 UPDATE OXA-432 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3535 UPDATE OXA-473 OXA-63-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3712 UPDATE Mycobacterium tuberculosis ppsC mutations confer resistance to pyrazinamide antibiotic resistant polyketide synthase genes; pyrazine antibiotic; antibiotic target alteration; ARO_category "DELETED 39997 " 3738 UPDATE Mycobacterium tuberculosis mshC mutations conferring resistance to ethionamide ethionamide resistant mshC; thioamide antibiotic; antibiotic target alteration; ARO_category "DELETED 40067 " 3426 UPDATE OXA-259 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3448 UPDATE OXA-283 OXA-134-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3477 UPDATE OXA-343 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3506 UPDATE OXA-433 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3536 UPDATE OXA-474 OXA-63-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3713 UPDATE Mycobacterium tuberculosis ppsD mutations confer resistance to pyrazinamide antibiotic resistant polyketide synthase genes; pyrazine antibiotic; antibiotic target alteration; ARO_category "DELETED 39997 " 3723 UPDATE Mycobacterium tuberculosis ahpC mutations confer resistance to isoniazid Isoniazid resistant ahpC; isoniazid-like antibiotic; antibiotic target alteration; model_param; ARO_category "UPDATED 13343 with G48A DELETED 9526 DELETED 41345 DELETED 36659 " 3128 UPDATE MCR-3.11 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 3129 UPDATE MCR-6.1 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 3130 UPDATE MCR-2.2 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 3131 UPDATE MCR-3.6 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 3132 UPDATE MCR-3.10 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 3133 UPDATE MCR-3.5 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 3134 UPDATE MCR-1.10 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 3135 UPDATE MCR-1.9 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 3136 UPDATE MCR-3.9 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 3137 UPDATE MCR-3.8 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 3138 UPDATE MCR-3.7 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 3139 UPDATE MCR-3.2 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 3141 UPDATE MCR-1.6 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 3142 UPDATE MCR-1.3 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 3143 UPDATE MCR-1.4 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 3145 UPDATE MCR-7.1 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 3744 UPDATE Mycobacterium tuberculosis ald mutations confer resistance to cycloserine cycloserine resistant ald; cycloserine-like antibiotic; antibiotic target alteration; ARO_category "DELETED 37140 " 3427 UPDATE OXA-260 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3449 UPDATE OXA-284 OXA-134-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3478 UPDATE OXA-344 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3507 UPDATE OXA-437 OXA-24-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3537 UPDATE OXA-475 OXA-63-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3724 UPDATE Mycobacterium tuberculosis fabG1 mutations confer resistance to isoniazid isoniazid resistant fabG1; isoniazid-like antibiotic; antibiotic target alteration; ARO_category "DELETED 36659 " 3740 UPDATE Mycobacterium tuberculosis ubiA mutations confer resistance to ethambutol ethambutol resistant ubiA; polyamine antibiotic; antibiotic target alteration; ARO_category "DELETED 36636 " 2614 UPDATE mphE macrolide phosphotransferase (MPH); macrolide antibiotic; antibiotic inactivation; ARO_category "DELETED 35925 " 3218 UPDATE mphN macrolide phosphotransferase (MPH); macrolide antibiotic; antibiotic inactivation; ARO_category "DELETED 35925 " 3219 UPDATE mphO macrolide phosphotransferase (MPH); macrolide antibiotic; antibiotic inactivation; ARO_category "DELETED 35925 " 3220 UPDATE mphJ macrolide phosphotransferase (MPH); macrolide antibiotic; antibiotic inactivation; ARO_category "DELETED 35925 " 3252 UPDATE Campylobacter jejuni 23S rRNA with mutation conferring resistance to erythromycin 23S rRNA with mutation conferring resistance to macrolide antibiotics; macrolide antibiotic; antibiotic target alteration; ARO_category "DELETED 35925 " 3256 UPDATE dfrA9 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 3996 UPDATE TEM-233 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 3285 UPDATE tet(49) tetracycline inactivation enzyme; tetracycline antibiotic; antibiotic inactivation; ARO_category "DELETED 35968 " 3257 UPDATE dfrB5 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 3289 UPDATE tet(52) tetracycline inactivation enzyme; tetracycline antibiotic; antibiotic inactivation; ARO_category "DELETED 35968 " 3294 UPDATE erm(32) Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 37625 " 3255 UPDATE dfrA6 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 3258 UPDATE dfrA27 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 3259 UPDATE dfrA28 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 3260 UPDATE dfrA30 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 3262 UPDATE dfrA29 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 3263 UPDATE dfrA32 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 3264 UPDATE dfrB7 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 3267 UPDATE Clostridioides difficile murG with mutation conferring resistance to vancomycin murG transferase; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 3266 UPDATE CAM-1 CAM beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35927 " 3270 UPDATE dfrA18 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 3271 UPDATE ICR-Mo intrinsic colistin resistant phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; model_sequences; ARO_category "UPDATED NCBI_taxonomy_name with Faucicola osloensis UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 3277 UPDATE Acinetobacter baumannii AbaF major facilitator superfamily (MFS) antibiotic efflux pump; phosphonic acid antibiotic; antibiotic efflux; ARO_category "DELETED 35944 " 3278 UPDATE Acinetobacter baumannii AbaQ major facilitator superfamily (MFS) antibiotic efflux pump; fluoroquinolone antibiotic; antibiotic efflux; ARO_category "DELETED 35988 " 3280 UPDATE Acinetobacter baumannii AmvA major facilitator superfamily (MFS) antibiotic efflux pump; macrolide antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 35925 " 3281 UPDATE Acinetobacter baumannii AbuO resistance-nodulation-cell division (RND) antibiotic efflux pump; aminoglycoside antibiotic; carbapenem; cephalosporin; glycylcycline; penicillin beta-lactam; tetracycline antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 35932 " 3283 UPDATE Klebsiella pneumoniae KpnE small multidrug resistance (SMR) antibiotic efflux pump; macrolide antibiotic; aminoglycoside antibiotic; cephalosporin; tetracycline antibiotic; peptide antibiotic; rifamycin antibiotic; disinfecting agents and antiseptics; nonribosomal peptide antibiotics; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35925 " 3284 UPDATE tet(48) tetracycline inactivation enzyme; tetracycline antibiotic; antibiotic inactivation; ARO_category "DELETED 35968 " 3286 UPDATE Klebsiella pneumoniae KpnF small multidrug resistance (SMR) antibiotic efflux pump; macrolide antibiotic; aminoglycoside antibiotic; cephalosporin; tetracycline antibiotic; peptide antibiotic; rifamycin antibiotic; disinfecting agents and antiseptics; nonribosomal peptide antibiotics; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35925 " 3287 UPDATE tet(50) tetracycline inactivation enzyme; tetracycline antibiotic; antibiotic inactivation; ARO_category "DELETED 35968 " 3288 UPDATE tet(51) tetracycline inactivation enzyme; tetracycline antibiotic; antibiotic inactivation; ARO_category "DELETED 35968 " 3290 UPDATE tet(53) tetracycline inactivation enzyme; tetracycline antibiotic; antibiotic inactivation; ARO_category "DELETED 35968 " 3291 UPDATE Erm(48) Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35925 " 3292 UPDATE tet(54) tetracycline inactivation enzyme; tetracycline antibiotic; antibiotic inactivation; ARO_category "DELETED 35968 " 3293 UPDATE tet(55) tetracycline inactivation enzyme; tetracycline antibiotic; antibiotic inactivation; ARO_category "DELETED 35968 " 3990 UPDATE TEM-227 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 3297 UPDATE erm(46) Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35925 " 3298 UPDATE Klebsiella pneumoniae KpnG major facilitator superfamily (MFS) antibiotic efflux pump; macrolide antibiotic; fluoroquinolone antibiotic; aminoglycoside antibiotic; carbapenem; cephalosporin; penicillin beta-lactam; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35925 " 3299 UPDATE Klebsiella pneumoniae KpnH major facilitator superfamily (MFS) antibiotic efflux pump; macrolide antibiotic; fluoroquinolone antibiotic; aminoglycoside antibiotic; carbapenem; cephalosporin; penicillin beta-lactam; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35925 " 3300 UPDATE clcD Cfr-like 23S rRNA methyltransferase; lincosamide antibiotic; streptogramin antibiotic; oxazolidinone antibiotic; phenicol antibiotic; pleuromutilin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Cfr-like 23S rRNA methyltransferase DELETED 35983 " 3450 UPDATE OXA-285 OXA-134-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3479 UPDATE OXA-345 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3508 UPDATE OXA-438 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3538 UPDATE OXA-476 OXA-63-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3715 UPDATE Mycobacterium tuberculosis mas mutations confer resistance to pyrazinamide pyrazinamide resistant mas; pyrazine antibiotic; antibiotic target alteration; ARO_category "DELETED 39997 " 3725 UPDATE Mycobacterium tuberculosis furA mutations confer resistance to isoniazid isoniazid resistant furA; isoniazid-like antibiotic; antibiotic target alteration; ARO_category "DELETED 36659 " 3750 UPDATE tet(57) major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 3751 UPDATE TEM-181 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 3754 UPDATE qacE major facilitator superfamily (MFS) antibiotic efflux pump; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 36298 " 3755 UPDATE qacEdelta1 major facilitator superfamily (MFS) antibiotic efflux pump; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 36298 " 3758 UPDATE VMB-1 VMB beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35979 " 3759 UPDATE APH(3')-VIb APH(3'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35924 " 3765 UPDATE FosL1 fosfomycin thiol transferase; phosphonic acid antibiotic; antibiotic inactivation; ARO_category "DELETED 35944 " 3763 UPDATE cfr(D) Cfr-like 23S rRNA methyltransferase; lincosamide antibiotic; streptogramin antibiotic; peptide antibiotic; oxazolidinone antibiotic; glycopeptide antibiotic; phenicol antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_name with Cfr-like 23S rRNA methyltransferase DELETED 35947 " 3773 UPDATE CTX-M-161 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 3774 UPDATE CTX-M-162 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 3775 UPDATE CTX-M-163 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 3776 UPDATE CTX-M-164 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 3777 UPDATE CTX-M-165 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 3778 UPDATE CTX-M-166 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 3786 UPDATE cmlA9 major facilitator superfamily (MFS) antibiotic efflux pump; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 36524 " 3787 UPDATE OmpA General Bacterial Porin with reduced permeability to peptide antibiotics; peptide antibiotic; nonribosomal peptide antibiotics; reduced permeability to antibiotic; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36593 " 3788 UPDATE SatA streptothricin acetyltransferase (SAT); nucleoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35931 " 3789 UPDATE BLMT Bleomycin resistant protein; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35970 " 3790 UPDATE MecC-type methicillin resistance repressor MecI gene modulating beta-lactam resistance; PBP2-like beta-lactam resistant peptidoglycan transpeptidase; penicillin beta-lactam; antibiotic target replacement; model_name; ARO_name; CARD_short_name; ARO_description; ARO_category "UPDATED model_name with mecC-type mecI UPDATED ARO_name with mecC-type mecI UPDATED CARD_short_name with mecC-type_mecI UPDATED ARO_description with A mecC-type mecI repressor gene which mediates production of PBP2 by mecC. In methicillin-resistant Staphylococci possessing the mecC gene, mecI represses the expression of mecC thereby restoring or increasing susceptibility to methicillin and beta-lactam antibiotics. UPDATED category_aro_accession with 3000100 UPDATED category_aro_cvterm_id with 36239 UPDATED category_aro_name with gene modulating beta-lactam resistance UPDATED category_aro_description with Genes that directly or indirectly modulate beta-lactam resistance. UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_accession with 3009312 UPDATED category_aro_cvterm_id with 48160 UPDATED category_aro_name with PBP2-like beta-lactam resistant peptidoglycan transpeptidase UPDATED category_aro_description with Peptidoglycan transpeptidase proteins involved in bacterial cell wall formation and which have decreased susceptibility to some beta-lactam antibiotics. These alternative transpeptidases are found in certain organisms, like Staphylococcus aureus, and have lower affinity for penicillin-like antibiotics, such as methicillin. In these organisms, these proteins do not bind to the beta-lactam ring and therefore transpeptidase activity continues in the presence of beta-lactams, thereby conferring resistance to these drugs. These proteins are commonly clinically associated with methicillin-resistant Staphylococcus aureus (MRSA). UPDATED category_aro_class_name with AMR Gene Family DELETED 37589 " 3791 UPDATE eptB pmr phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36593 " 3792 UPDATE CrcB multidrug and toxic compound extrusion (MATE) transporter; aminoglycoside antibiotic; antibiotic efflux; ARO_category "DELETED 35969 " 3793 UPDATE LpsB Intrinsic peptide antibiotic resistant Lps; peptide antibiotic; nonribosomal peptide antibiotics; reduced permeability to antibiotic; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 3794 UPDATE LpsA Intrinsic peptide antibiotic resistant Lps; peptide antibiotic; nonribosomal peptide antibiotics; reduced permeability to antibiotic; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36593 " 3795 UPDATE ArnT pmr phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 3785 UPDATE mlaD ATP-binding cassette (ABC) antibiotic efflux pump; peptide antibiotic; oxazolidinone antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 3784 UPDATE mlaF ATP-binding cassette (ABC) antibiotic efflux pump; peptide antibiotic; oxazolidinone antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 3799 UPDATE LptD ATP-binding cassette (ABC) antibiotic efflux pump; carbapenem; peptide antibiotic; aminocoumarin antibiotic; rifamycin antibiotic; nonribosomal peptide antibiotics; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36250 " 3800 UPDATE OXA-837 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 3801 UPDATE AAC(3)-IVb AAC(3); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35969 " 3802 UPDATE ANT(3'')-Ib ANT(3''); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35957 " 3803 UPDATE cprR pmr phosphoethanolamine transferase; antibiotic efflux regulatory protein; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36593 " 3804 UPDATE cprS pmr phosphoethanolamine transferase; antibiotic efflux regulatory protein; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36593 " 3805 UPDATE ParS resistance-nodulation-cell division (RND) antibiotic efflux pump; Outer Membrane Porin (Opr); antibiotic efflux regulatory protein; macrolide antibiotic; fluoroquinolone antibiotic; monobactam; aminoglycoside antibiotic; carbapenem; cephalosporin; penicillin beta-lactam; tetracycline antibiotic; phenicol antibiotic; disinfecting agents and antiseptics; antibiotic efflux; reduced permeability to antibiotic; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35925 " 3806 UPDATE ParR resistance-nodulation-cell division (RND) antibiotic efflux pump; Outer Membrane Porin (Opr); antibiotic efflux regulatory protein; macrolide antibiotic; fluoroquinolone antibiotic; monobactam; aminoglycoside antibiotic; carbapenem; cephalosporin; penicillin beta-lactam; tetracycline antibiotic; phenicol antibiotic; disinfecting agents and antiseptics; antibiotic efflux; reduced permeability to antibiotic; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35925 " 3807 UPDATE rsmA resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; fluoroquinolone antibiotic; diaminopyrimidine antibiotic; phenicol antibiotic; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 36327 " 3817 UPDATE Thermus thermophilus uL3 mutations conferring resistance to pleuromutilin antibiotics Ribosomal protein mutation conferring resistance to pleuromutilin antibiotics; pleuromutilin antibiotic; antibiotic target alteration; ARO_category "DELETED 37015 " 3818 UPDATE Thermus thermophilus 23s rRNA conferring resistance to pleuromutilin antibiotics 23S rRNA with mutation conferring resistance to pleuromutilin antibiotics; pleuromutilin antibiotic; antibiotic target alteration; ARO_category "DELETED 37015 " 3819 UPDATE dfrA31 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 3820 UPDATE AAC(3)-IIg AAC(3); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 3798 UPDATE tet(X5) tetracycline inactivation enzyme; tetracycline antibiotic; antibiotic inactivation; ARO_category "DELETED 35968 " 3821 UPDATE msrF msr-type ABC-F protein; macrolide antibiotic; streptogramin antibiotic; antibiotic target protection; model_sequences; ARO_category "UPDATED NCBI_taxonomy_name with Macrococcoides canis DELETED 35925 " 3822 UPDATE msrH msr-type ABC-F protein; macrolide antibiotic; streptogramin antibiotic; antibiotic target protection; model_sequences; ARO_category "UPDATED NCBI_taxonomy_name with Macrococcoides canis DELETED 35925 " 3823 UPDATE mef(D) major facilitator superfamily (MFS) antibiotic efflux pump; macrolide antibiotic; antibiotic efflux; model_sequences; ARO_category "UPDATED NCBI_taxonomy_name with Macrococcoides canis DELETED 35925 " 3824 UPDATE RanB ATP-binding cassette (ABC) antibiotic efflux pump; aminoglycoside antibiotic; antibiotic efflux; ARO_category "DELETED 36298 " 3825 UPDATE RanA ATP-binding cassette (ABC) antibiotic efflux pump; aminoglycoside antibiotic; antibiotic efflux; ARO_category "DELETED 36298 " 3826 UPDATE OXA-899 OXA-22-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3827 UPDATE OXA-898 OXA-60-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 2323 UPDATE qacH small multidrug resistance (SMR) antibiotic efflux pump; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 36298 " 3830 UPDATE qacL small multidrug resistance (SMR) antibiotic efflux pump; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 36298 " 3831 UPDATE 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(A) Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35925 " 3832 UPDATE FosB2 fosfomycin thiol transferase; phosphonic acid antibiotic; antibiotic inactivation; ARO_category "DELETED 35944 " 3834 UPDATE Mycobacterium tuberculosis katG mutations conferring resistance to prothionamide prothionamide resistant katG; thioamide antibiotic; antibiotic target alteration; ARO_category "DELETED 40958 " 3836 UPDATE Mycobacterium tuberculosis ethA mutations conferring resistance to isoniazid isoniazid resistant ethA; isoniazid-like antibiotic; antibiotic target alteration; ARO_category "DELETED 36659 " 3837 UPDATE Mycobacterium tuberculosis ethA mutations conferring resistance to prothionamide prothionamide resistant ethA; thioamide antibiotic; antibiotic target alteration; ARO_category "DELETED 40958 " 3838 UPDATE Mycobacterium tuberculosis mshA mutations conferring resistance to prothionamide prothionamide resistant mshA; thioamide antibiotic; antibiotic target alteration; ARO_category "DELETED 40958 " 3839 UPDATE blaS1 blaS; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35927 " 3840 UPDATE AAC(6')-Ib-cr3 AAC(6'); AAC(6')-Ib-cr; fluoroquinolone antibiotic; aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35932 " 3841 UPDATE AAC(6')-Ib-cr4 AAC(6'); AAC(6')-Ib-cr; fluoroquinolone antibiotic; aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35932 " 3842 UPDATE AAC(6')-Ib-cr5 AAC(6'); AAC(6')-Ib-cr; fluoroquinolone antibiotic; aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35932 " 3843 UPDATE AAC(6')-Ib-cr6 AAC(6'); AAC(6')-Ib-cr; fluoroquinolone antibiotic; aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35932 " 3844 UPDATE AAC(6')-Ib-cr7 AAC(6'); AAC(6')-Ib-cr; fluoroquinolone antibiotic; aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35932 " 3845 UPDATE AAC(6')-Ib-cr8 AAC(6'); AAC(6')-Ib-cr; fluoroquinolone antibiotic; aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35932 " 3846 UPDATE AAC(6')-Ib-cr9 AAC(6'); AAC(6')-Ib-cr; fluoroquinolone antibiotic; aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35932 " 3856 UPDATE OXA-846 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3862 UPDATE OXA-906 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3864 UPDATE OXA-850 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3991 UPDATE TEM-228 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 3883 UPDATE OXA-668 OXA-274-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3884 UPDATE OXA-818 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3885 UPDATE OXA-812 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3276 UPDATE Staphylococcus aureus LmrS major facilitator superfamily (MFS) antibiotic efflux pump; macrolide antibiotic; aminoglycoside antibiotic; oxazolidinone antibiotic; diaminopyrimidine antibiotic; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 35925 " 3886 UPDATE FosA7.5 fosfomycin thiol transferase; phosphonic acid antibiotic; antibiotic inactivation; ARO_category "DELETED 35944 " 3887 UPDATE dfrA35 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 3992 UPDATE TEM-229 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 3993 UPDATE TEM-230 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 3944 UPDATE OXA-544 OXA-2-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 3976 UPDATE TEM-5 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 3977 UPDATE TEM-9 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 3978 UPDATE TEM-31 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 3979 UPDATE TEM-32 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 3980 UPDATE TEM-35 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 3981 UPDATE TEM-36 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 3982 UPDATE TEM-37 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 3983 UPDATE TEM-39 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 3985 UPDATE TEM-210 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 3986 UPDATE TEM-212 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 3987 UPDATE TEM-224 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 3988 UPDATE TEM-225 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 3989 UPDATE TEM-226 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 3997 UPDATE TEM-234 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 3998 UPDATE TEM-235 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 3999 UPDATE TEM-236 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 4000 UPDATE TEM-237 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 4001 UPDATE TEM-238 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 4002 UPDATE TEM-240 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 4003 UPDATE TEM-241 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 4004 UPDATE TEM-242 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 4005 UPDATE TEM-243 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 4046 UPDATE OXA-540 OXA-2-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4047 UPDATE OXA-779 OXA-46-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4048 UPDATE OXA-838 OXA-2-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4049 UPDATE OXA-539 OXA-2-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4050 UPDATE OXA-543 OXA-2-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4051 UPDATE OXA-681 OXA-2-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4052 UPDATE OXA-737 OXA-2-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4053 UPDATE OXA-541 OXA-2-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4054 UPDATE OXA-835 OXA-46-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4055 UPDATE OXA-926 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 4056 UPDATE OXA-570 OXA-60-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4057 UPDATE OXA-573 OXA-60-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4058 UPDATE OXA-571 OXA-60-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4059 UPDATE OXA-672 OXA-286-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4060 UPDATE OXA-671 OXA-286-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4061 UPDATE OXA-673 OXA-286-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4062 UPDATE OXA-931 OXA-229-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4063 UPDATE OXA-930 OXA-229-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4064 UPDATE OXA-895 OXA-229-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4065 UPDATE OXA-641 OXA-372-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4066 UPDATE Trimethoprim-resistant dihydrofolate reductase DfrA42 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 4067 UPDATE OXA-496 OXA-134-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4068 UPDATE OXA-915 OXA-134-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4070 UPDATE OXA-648 OXA-134-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4071 UPDATE OXA-646 OXA-134-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4072 UPDATE OXA-649 OXA-143-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4073 UPDATE OXA-897 OXA-24-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4074 UPDATE OXA-653 OXA-24-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4075 UPDATE OXA-499 OXA-143-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4076 UPDATE OXA-825 OXA-143-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4077 UPDATE Trimethoprim-resistant dihydrofolate reductase DfrA43 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 4078 UPDATE DfrA34 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 4079 UPDATE DfrA37 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 4080 UPDATE DfrA36 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 4081 UPDATE DfrA38 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 4082 UPDATE DfrB9 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 4083 UPDATE DfrA39 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 4085 UPDATE dfr22 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 4123 UPDATE ACC-1a ACC beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35976 " 4124 UPDATE ACC-1b ACC beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35976 " 4125 UPDATE ACC-1c ACC beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35976 " 4126 UPDATE ACC-1d ACC beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35976 " 4127 UPDATE ACC-7 ACC beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 4128 UPDATE ACC-8 ACC beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 4488 UPDATE CTX-M-127 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4489 UPDATE CTX-M-138 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4490 UPDATE CTX-M-140 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4491 UPDATE CTX-M-143 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4492 UPDATE CTX-M-146 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4493 UPDATE CTX-M-150 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4494 UPDATE CTX-M-153 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4495 UPDATE CTX-M-154 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4496 UPDATE CTX-M-167 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4497 UPDATE CTX-M-168 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4498 UPDATE CTX-M-169 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4499 UPDATE CTX-M-170 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4500 UPDATE CTX-M-171 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4501 UPDATE CTX-M-172 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4502 UPDATE CTX-M-173 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4503 UPDATE CTX-M-174 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4504 UPDATE CTX-M-175 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4505 UPDATE CTX-M-176 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4506 UPDATE CTX-M-177 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4507 UPDATE CTX-M-178 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4508 UPDATE CTX-M-179 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4509 UPDATE CTX-M-180 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4510 UPDATE CTX-M-181 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4511 UPDATE CTX-M-182 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4512 UPDATE CTX-M-183 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4513 UPDATE CTX-M-184 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4514 UPDATE CTX-M-185 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4515 UPDATE CTX-M-186 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4516 UPDATE CTX-M-187 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4517 UPDATE CTX-M-188 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4518 UPDATE CTX-M-189 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4519 UPDATE CTX-M-190 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4520 UPDATE CTX-M-191 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4521 UPDATE CTX-M-192 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4522 UPDATE CTX-M-193 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4523 UPDATE CTX-M-194 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4524 UPDATE CTX-M-195 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4525 UPDATE CTX-M-196 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4526 UPDATE CTX-M-197 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4527 UPDATE CTX-M-198 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4528 UPDATE CTX-M-199 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4529 UPDATE CTX-M-200 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4530 UPDATE CTX-M-201 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4531 UPDATE CTX-M-202 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4532 UPDATE CTX-M-203 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4533 UPDATE CTX-M-204 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4534 UPDATE CTX-M-205 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4535 UPDATE CTX-M-206 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4536 UPDATE CTX-M-207 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4537 UPDATE CTX-M-208 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4538 UPDATE CTX-M-209 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4539 UPDATE CTX-M-210 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4540 UPDATE CTX-M-211 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4541 UPDATE CTX-M-212 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4542 UPDATE CTX-M-213 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4543 UPDATE CTX-M-214 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4544 UPDATE CTX-M-215 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4545 UPDATE CTX-M-216 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4546 UPDATE CTX-M-217 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4547 UPDATE CTX-M-218 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4548 UPDATE CTX-M-219 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4549 UPDATE CTX-M-220 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4550 UPDATE CTX-M-221 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4551 UPDATE CTX-M-222 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4552 UPDATE CTX-M-223 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4553 UPDATE CTX-M-224 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4554 UPDATE CTX-M-225 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4555 UPDATE CTX-M-226 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4556 UPDATE CTX-M-227 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4557 UPDATE CTX-M-228 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4558 UPDATE CTX-M-229 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4559 UPDATE CTX-M-230 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4560 UPDATE CTX-M-231 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4561 UPDATE CTX-M-232 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4562 UPDATE CTX-M-233 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4563 UPDATE CTX-M-234 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4564 UPDATE CTX-M-235 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4565 UPDATE CTX-M-236 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4566 UPDATE CTX-M-237 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4567 UPDATE CTX-M-238 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4568 UPDATE CTX-M-239 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4569 UPDATE CTX-M-240 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4570 UPDATE CTX-M-241 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4571 UPDATE CTX-M-242 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4572 UPDATE CTX-M-244 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4573 UPDATE CTX-M-73 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4574 UPDATE CTX-M-97 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 4666 UPDATE IMI-12 IMI beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 0000032 UPDATED category_aro_cvterm_id with 35951 UPDATED category_aro_name with cephalosporin UPDATED category_aro_description with Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000008 UPDATED category_aro_cvterm_id with 36017 UPDATED category_aro_name with penicillin beta-lactam UPDATED category_aro_description with Penicilins (Penams) are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. Penicillin-like antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_class_name with Drug Class " 4667 UPDATE IMI-13 IMI beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 0000032 UPDATED category_aro_cvterm_id with 35951 UPDATED category_aro_name with cephalosporin UPDATED category_aro_description with Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000008 UPDATED category_aro_cvterm_id with 36017 UPDATED category_aro_name with penicillin beta-lactam UPDATED category_aro_description with Penicilins (Penams) are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. Penicillin-like antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_class_name with Drug Class " 4668 UPDATE IMI-14 IMI beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 0000032 UPDATED category_aro_cvterm_id with 35951 UPDATED category_aro_name with cephalosporin UPDATED category_aro_description with Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000008 UPDATED category_aro_cvterm_id with 36017 UPDATED category_aro_name with penicillin beta-lactam UPDATED category_aro_description with Penicilins (Penams) are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. Penicillin-like antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_class_name with Drug Class " 4669 UPDATE IMI-15 IMI beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 0000032 UPDATED category_aro_cvterm_id with 35951 UPDATED category_aro_name with cephalosporin UPDATED category_aro_description with Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000008 UPDATED category_aro_cvterm_id with 36017 UPDATED category_aro_name with penicillin beta-lactam UPDATED category_aro_description with Penicilins (Penams) are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. Penicillin-like antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_class_name with Drug Class " 4670 UPDATE IMI-16 IMI beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 0000032 UPDATED category_aro_cvterm_id with 35951 UPDATED category_aro_name with cephalosporin UPDATED category_aro_description with Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000008 UPDATED category_aro_cvterm_id with 36017 UPDATED category_aro_name with penicillin beta-lactam UPDATED category_aro_description with Penicilins (Penams) are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. Penicillin-like antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_class_name with Drug Class " 4671 UPDATE IMI-17 IMI beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 0000032 UPDATED category_aro_cvterm_id with 35951 UPDATED category_aro_name with cephalosporin UPDATED category_aro_description with Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000008 UPDATED category_aro_cvterm_id with 36017 UPDATED category_aro_name with penicillin beta-lactam UPDATED category_aro_description with Penicilins (Penams) are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. Penicillin-like antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_class_name with Drug Class " 4672 UPDATE IMI-18 IMI beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 0000032 UPDATED category_aro_cvterm_id with 35951 UPDATED category_aro_name with cephalosporin UPDATED category_aro_description with Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000008 UPDATED category_aro_cvterm_id with 36017 UPDATED category_aro_name with penicillin beta-lactam UPDATED category_aro_description with Penicilins (Penams) are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. Penicillin-like antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_class_name with Drug Class " 4673 UPDATE IMI-19 IMI beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 0000032 UPDATED category_aro_cvterm_id with 35951 UPDATED category_aro_name with cephalosporin UPDATED category_aro_description with Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000008 UPDATED category_aro_cvterm_id with 36017 UPDATED category_aro_name with penicillin beta-lactam UPDATED category_aro_description with Penicilins (Penams) are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. Penicillin-like antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_class_name with Drug Class " 4674 UPDATE IMI-20 IMI beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 0000032 UPDATED category_aro_cvterm_id with 35951 UPDATED category_aro_name with cephalosporin UPDATED category_aro_description with Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000008 UPDATED category_aro_cvterm_id with 36017 UPDATED category_aro_name with penicillin beta-lactam UPDATED category_aro_description with Penicilins (Penams) are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. Penicillin-like antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_class_name with Drug Class " 4675 UPDATE IMI-21 IMI beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 0000032 UPDATED category_aro_cvterm_id with 35951 UPDATED category_aro_name with cephalosporin UPDATED category_aro_description with Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000008 UPDATED category_aro_cvterm_id with 36017 UPDATED category_aro_name with penicillin beta-lactam UPDATED category_aro_description with Penicilins (Penams) are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. Penicillin-like antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_class_name with Drug Class " 4676 UPDATE IMI-5 IMI beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 0000032 UPDATED category_aro_cvterm_id with 35951 UPDATED category_aro_name with cephalosporin UPDATED category_aro_description with Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000008 UPDATED category_aro_cvterm_id with 36017 UPDATED category_aro_name with penicillin beta-lactam UPDATED category_aro_description with Penicilins (Penams) are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. Penicillin-like antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_class_name with Drug Class " 4677 UPDATE IMI-6 IMI beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 0000032 UPDATED category_aro_cvterm_id with 35951 UPDATED category_aro_name with cephalosporin UPDATED category_aro_description with Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000008 UPDATED category_aro_cvterm_id with 36017 UPDATED category_aro_name with penicillin beta-lactam UPDATED category_aro_description with Penicilins (Penams) are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. Penicillin-like antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_class_name with Drug Class " 4678 UPDATE IMI-9 IMI beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 0000032 UPDATED category_aro_cvterm_id with 35951 UPDATED category_aro_name with cephalosporin UPDATED category_aro_description with Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000008 UPDATED category_aro_cvterm_id with 36017 UPDATED category_aro_name with penicillin beta-lactam UPDATED category_aro_description with Penicilins (Penams) are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. Penicillin-like antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_class_name with Drug Class " 4802 UPDATE OXA-114b OXA-114-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4803 UPDATE OXA-114c OXA-114-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4804 UPDATE OXA-114d OXA-114-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4805 UPDATE OXA-114e OXA-114-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4806 UPDATE OXA-114f OXA-114-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4807 UPDATE OXA-114g OXA-114-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4808 UPDATE OXA-114h OXA-114-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4809 UPDATE OXA-114i OXA-114-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4810 UPDATE OXA-114j OXA-114-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4811 UPDATE OXA-114k OXA-114-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4812 UPDATE OXA-114l OXA-114-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4813 UPDATE OXA-114m OXA-114-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4814 UPDATE OXA-114n OXA-114-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4815 UPDATE OXA-114p OXA-114-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4816 UPDATE OXA-114q OXA-114-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4817 UPDATE OXA-114r OXA-114-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4818 UPDATE OXA-114s OXA-114-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4819 UPDATE OXA-114t OXA-114-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4820 UPDATE OXA-114u OXA-114-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4821 UPDATE OXA-114v OXA-114-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4822 UPDATE OXA-114w OXA-114-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4823 UPDATE OXA-114x OXA-114-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4824 UPDATE OXA-159 OXA-62-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4825 UPDATE OXA-193 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4826 UPDATE OXA-307 OXA-286-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4827 UPDATE OXA-395 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4828 UPDATE OXA-396 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4829 UPDATE OXA-489 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4830 UPDATE OXA-491 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 4831 UPDATE OXA-493 OXA-493-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4832 UPDATE OXA-494 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4833 UPDATE OXA-497 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4834 UPDATE OXA-498 OXA-211-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4835 UPDATE OXA-500 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4836 UPDATE OXA-501 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4837 UPDATE OXA-502 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4838 UPDATE OXA-503 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4839 UPDATE OXA-504 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 4840 UPDATE OXA-505 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4841 UPDATE OXA-506 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4842 UPDATE OXA-507 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4843 UPDATE OXA-508 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4844 UPDATE OXA-509 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4845 UPDATE OXA-510 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4846 UPDATE OXA-511 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4847 UPDATE OXA-512 OXA-58-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4848 UPDATE OXA-513 OXA-364-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4849 UPDATE OXA-514 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4850 UPDATE OXA-515 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4851 UPDATE OXA-516 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4852 UPDATE OXA-517 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4853 UPDATE OXA-518 OXA-493-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4854 UPDATE OXA-519 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4855 UPDATE OXA-520 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4856 UPDATE OXA-521 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4857 UPDATE OXA-522 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4858 UPDATE OXA-523 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4859 UPDATE OXA-524 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4860 UPDATE OXA-525 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4861 UPDATE OXA-526 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4862 UPDATE OXA-527 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 4863 UPDATE OXA-528 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4864 UPDATE OXA-529 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4865 UPDATE OXA-530 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4866 UPDATE OXA-531 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4867 UPDATE OXA-532 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4868 UPDATE OXA-533 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4869 UPDATE OXA-534 OXA-1-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4870 UPDATE OXA-536 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4871 UPDATE OXA-537 OXA-134-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4872 UPDATE OXA-538 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4873 UPDATE OXA-542 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 4874 UPDATE OXA-545 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4875 UPDATE OXA-546 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4876 UPDATE OXA-547 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4877 UPDATE OXA-548 OXA-548-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4878 UPDATE OXA-549 OXA-548-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4879 UPDATE OXA-550 OXA-548-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4880 UPDATE OXA-551 OXA-548-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4881 UPDATE OXA-552 OXA-548-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4882 UPDATE OXA-553 OXA-548-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4883 UPDATE OXA-554 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4884 UPDATE OXA-555 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4885 UPDATE OXA-556 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4886 UPDATE OXA-557 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4887 UPDATE OXA-558 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4888 UPDATE OXA-559 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4889 UPDATE OXA-560 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4890 UPDATE OXA-561 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4891 UPDATE OXA-562 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4892 UPDATE OXA-563 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4893 UPDATE OXA-564 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4894 UPDATE OXA-565 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4895 UPDATE OXA-566 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4896 UPDATE OXA-567 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4897 UPDATE OXA-568 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 4898 UPDATE OXA-569 OXA-22-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4899 UPDATE OXA-572 OXA-22-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4900 UPDATE OXA-574 OXA-22-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4901 UPDATE OXA-575 OXA-214-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4902 UPDATE OXA-576 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 4903 UPDATE OXA-577 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4904 UPDATE OXA-578 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4905 UPDATE OXA-579 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4906 UPDATE OXA-580 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4907 UPDATE OXA-581 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4908 UPDATE OXA-582 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4909 UPDATE OXA-583 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4910 UPDATE OXA-584 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4911 UPDATE OXA-585 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4912 UPDATE OXA-586 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4913 UPDATE OXA-587 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4914 UPDATE OXA-588 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4915 UPDATE OXA-589 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4916 UPDATE OXA-590 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4917 UPDATE OXA-591 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4918 UPDATE OXA-592 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4919 UPDATE OXA-593 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4920 UPDATE OXA-594 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4921 UPDATE OXA-595 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4922 UPDATE OXA-596 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4923 UPDATE OXA-597 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4924 UPDATE OXA-598 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4925 UPDATE OXA-599 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4926 UPDATE OXA-600 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4927 UPDATE OXA-601 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4928 UPDATE OXA-602 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4929 UPDATE OXA-603 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4930 UPDATE OXA-604 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4931 UPDATE OXA-605 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4932 UPDATE OXA-606 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4933 UPDATE OXA-607 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4934 UPDATE OXA-608 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4935 UPDATE OXA-609 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4936 UPDATE OXA-610 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4937 UPDATE OXA-611 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4938 UPDATE OXA-612 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4939 UPDATE OXA-613 OXA-184-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4940 UPDATE OXA-614 OXA-184-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4941 UPDATE OXA-615 OXA-184-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4942 UPDATE OXA-616 OXA-184-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4943 UPDATE OXA-617 OXA-184-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4944 UPDATE OXA-618 OXA-184-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4945 UPDATE OXA-619 OXA-184-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4946 UPDATE OXA-620 OXA-184-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4947 UPDATE OXA-621 OXA-184-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4948 UPDATE OXA-622 OXA-184-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4949 UPDATE OXA-623 OXA-184-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4950 UPDATE OXA-624 OXA-184-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4951 UPDATE OXA-625 OXA-184-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4952 UPDATE OXA-626 OXA-184-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4953 UPDATE OXA-627 OXA-184-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4954 UPDATE OXA-628 OXA-184-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4955 UPDATE OXA-629 OXA-184-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4956 UPDATE OXA-630 OXA-184-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4957 UPDATE OXA-631 OXA-184-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4958 UPDATE OXA-632 OXA-184-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4959 UPDATE OXA-633 OXA-184-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4960 UPDATE OXA-634 OXA-184-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4961 UPDATE OXA-635 OXA-184-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4962 UPDATE OXA-636 OXA-184-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4963 UPDATE OXA-637 OXA-184-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4964 UPDATE OXA-638 OXA-184-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4965 UPDATE OXA-639 OXA-184-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4966 UPDATE OXA-640 OXA-184-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4967 UPDATE OXA-642 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4968 UPDATE OXA-643 OXA-211-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4969 UPDATE OXA-644 OXA-211-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4970 UPDATE OXA-645 OXA-211-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4971 UPDATE OXA-650 OXA-211-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4972 UPDATE OXA-651 OXA-211-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4973 UPDATE OXA-652 OXA-211-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4974 UPDATE OXA-654 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4975 UPDATE OXA-655 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4976 UPDATE OXA-656 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4977 UPDATE OXA-657 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4978 UPDATE OXA-658 OXA-184-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4979 UPDATE OXA-659 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4980 UPDATE OXA-660 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4981 UPDATE OXA-661 OXA-266-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4982 UPDATE OXA-662 OXA-211-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4983 UPDATE OXA-666 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 4984 UPDATE OXA-667 OXA-274-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4985 UPDATE OXA-669 OXA-274-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4986 UPDATE OXA-670 OXA-286-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4987 UPDATE OXA-674 OXA-286-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4988 UPDATE OXA-675 OXA-1-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4989 UPDATE OXA-676 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4990 UPDATE OXA-677 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4991 UPDATE OXA-678 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4992 UPDATE OXA-679 OXA-679-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4993 UPDATE OXA-680 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4994 UPDATE OXA-682 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4995 UPDATE OXA-683 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4996 UPDATE OXA-684 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4997 UPDATE OXA-685 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4998 UPDATE OXA-686 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 4999 UPDATE OXA-687 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5000 UPDATE OXA-688 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5001 UPDATE OXA-689 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5002 UPDATE OXA-690 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5003 UPDATE OXA-691 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5004 UPDATE OXA-692 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5005 UPDATE OXA-693 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5006 UPDATE OXA-694 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5007 UPDATE OXA-695 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5008 UPDATE OXA-696 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5009 UPDATE OXA-697 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5010 UPDATE OXA-698 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5011 UPDATE OXA-699 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5012 UPDATE OXA-700 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5013 UPDATE OXA-701 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5014 UPDATE OXA-702 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5015 UPDATE OXA-703 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5016 UPDATE OXA-704 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5017 UPDATE OXA-705 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5018 UPDATE OXA-706 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5019 UPDATE OXA-707 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5020 UPDATE OXA-708 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5021 UPDATE OXA-709 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5022 UPDATE OXA-710 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5023 UPDATE OXA-711 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5024 UPDATE OXA-712 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5025 UPDATE OXA-713 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5026 UPDATE OXA-714 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5027 UPDATE OXA-715 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5028 UPDATE OXA-716 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5029 UPDATE OXA-717 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5030 UPDATE OXA-718 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5031 UPDATE OXA-719 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5032 UPDATE OXA-720 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5033 UPDATE OXA-721 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5034 UPDATE OXA-722 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5035 UPDATE OXA-723 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5036 UPDATE OXA-726 OXA-12-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5037 UPDATE OXA-727 OXA-727-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5038 UPDATE OXA-728 OXA-727-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5039 UPDATE OXA-729 OXA-55-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5040 UPDATE OXA-730 OXA-679-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5041 UPDATE OXA-731 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5042 UPDATE OXA-732 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 5043 UPDATE OXA-733 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5044 UPDATE OXA-734 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5045 UPDATE OXA-735 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5046 UPDATE OXA-736 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5047 UPDATE OXA-738 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5048 UPDATE OXA-739 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5049 UPDATE OXA-740 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5050 UPDATE OXA-741 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5051 UPDATE OXA-742 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5052 UPDATE OXA-743 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5053 UPDATE OXA-744 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5054 UPDATE OXA-745 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5055 UPDATE OXA-746 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5056 UPDATE OXA-747 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5057 UPDATE OXA-748 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5058 UPDATE OXA-749 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5059 UPDATE OXA-750 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5060 UPDATE OXA-751 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5061 UPDATE OXA-752 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5062 UPDATE OXA-753 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5063 UPDATE OXA-754 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5064 UPDATE OXA-755 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5065 UPDATE OXA-756 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5066 UPDATE OXA-757 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5067 UPDATE OXA-758 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5068 UPDATE OXA-759 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5069 UPDATE OXA-760 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5070 UPDATE OXA-761 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5071 UPDATE OXA-762 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5072 UPDATE OXA-763 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5073 UPDATE OXA-764 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5074 UPDATE OXA-765 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5075 UPDATE OXA-766 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5076 UPDATE OXA-767 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5077 UPDATE OXA-768 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5078 UPDATE OXA-769 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5079 UPDATE OXA-770 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5080 UPDATE OXA-771 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5081 UPDATE OXA-772 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5082 UPDATE OXA-773 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5083 UPDATE OXA-774 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5084 UPDATE OXA-775 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5085 UPDATE OXA-776 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5086 UPDATE OXA-777 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5087 UPDATE OXA-778 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5088 UPDATE OXA-780 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 5089 UPDATE OXA-781 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5090 UPDATE OXA-782 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5091 UPDATE OXA-783 OXA-184-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5092 UPDATE OXA-784 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5093 UPDATE OXA-785 OXA-184-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5094 UPDATE OXA-786 OXA-61-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5095 UPDATE OXA-787 OXA-364-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5096 UPDATE OXA-788 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5097 UPDATE OXA-789 OXA-364-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5098 UPDATE OXA-793 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5099 UPDATE OXA-794 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5100 UPDATE OXA-795 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5101 UPDATE OXA-796 OXA-1-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5102 UPDATE OXA-797 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5103 UPDATE OXA-798 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5104 UPDATE OXA-799 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5105 UPDATE OXA-800 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5106 UPDATE OXA-801 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5107 UPDATE OXA-802 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5108 UPDATE OXA-803 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5109 UPDATE OXA-804 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5110 UPDATE OXA-805 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5111 UPDATE OXA-806 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5112 UPDATE OXA-807 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5113 UPDATE OXA-808 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5114 UPDATE OXA-809 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5115 UPDATE OXA-810 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5116 UPDATE OXA-811 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5117 UPDATE OXA-813 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5118 UPDATE OXA-814 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5119 UPDATE OXA-815 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5120 UPDATE OXA-816 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5121 UPDATE OXA-817 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5122 UPDATE OXA-819 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5123 UPDATE OXA-820 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5124 UPDATE OXA-821 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5125 UPDATE OXA-822 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5126 UPDATE OXA-823 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5127 UPDATE OXA-824 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5128 UPDATE OXA-826 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5129 UPDATE OXA-827 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5130 UPDATE OXA-828 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5131 UPDATE OXA-829 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5132 UPDATE OXA-830 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 5133 UPDATE OXA-831 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5134 UPDATE OXA-832 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5135 UPDATE OXA-833 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5136 UPDATE OXA-834 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5137 UPDATE OXA-836 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5138 UPDATE OXA-839 OXA-114-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5139 UPDATE OXA-840 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5140 UPDATE OXA-841 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5141 UPDATE OXA-842 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5142 UPDATE OXA-843 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5143 UPDATE OXA-844 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5144 UPDATE OXA-845 OXA-214-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5145 UPDATE OXA-847 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5146 UPDATE OXA-848 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5147 UPDATE OXA-849 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5148 UPDATE OXA-851 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5149 UPDATE OXA-852 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5150 UPDATE OXA-853 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5151 UPDATE OXA-854 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5152 UPDATE OXA-855 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5153 UPDATE OXA-856 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5154 UPDATE OXA-857 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5155 UPDATE OXA-858 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5156 UPDATE OXA-859 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5157 UPDATE OXA-860 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5158 UPDATE OXA-861 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5159 UPDATE OXA-862 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5160 UPDATE OXA-863 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5161 UPDATE OXA-864 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5162 UPDATE OXA-865 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5163 UPDATE OXA-866 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5164 UPDATE OXA-867 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5165 UPDATE OXA-868 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5166 UPDATE OXA-869 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5167 UPDATE OXA-870 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5168 UPDATE OXA-871 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5169 UPDATE OXA-872 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5170 UPDATE OXA-873 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5171 UPDATE OXA-874 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5172 UPDATE OXA-875 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5173 UPDATE OXA-876 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5174 UPDATE OXA-877 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5175 UPDATE OXA-878 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5176 UPDATE OXA-879 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5177 UPDATE OXA-880 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5178 UPDATE OXA-881 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5179 UPDATE OXA-882 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5180 UPDATE OXA-883 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5181 UPDATE OXA-884 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5182 UPDATE OXA-885 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5183 UPDATE OXA-886 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5184 UPDATE OXA-887 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5185 UPDATE OXA-888 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5186 UPDATE OXA-889 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5187 UPDATE OXA-890 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5188 UPDATE OXA-891 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5189 UPDATE OXA-892 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5190 UPDATE OXA-893 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5191 UPDATE OXA-894 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5192 UPDATE OXA-896 OXA-9-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5193 UPDATE OXA-900 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 5194 UPDATE OXA-901 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5195 UPDATE OXA-902 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5196 UPDATE OXA-903 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5197 UPDATE OXA-904 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5198 UPDATE OXA-905 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5199 UPDATE OXA-907 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5200 UPDATE OXA-908 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5201 UPDATE OXA-909 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5202 UPDATE OXA-910 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5203 UPDATE OXA-911 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5204 UPDATE OXA-912 OXA-12-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5205 UPDATE OXA-913 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5206 UPDATE OXA-914 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5207 UPDATE OXA-916 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5208 UPDATE OXA-917 OXA-427-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5209 UPDATE OXA-918 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5210 UPDATE OXA-919 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 5211 UPDATE OXA-920 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5212 UPDATE OXA-921 OXA-1-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5213 UPDATE OXA-922 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5214 UPDATE OXA-923 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5215 UPDATE OXA-924 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5216 UPDATE OXA-925 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 5217 UPDATE OXA-927 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5218 UPDATE OXA-928 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5219 UPDATE OXA-929 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5220 UPDATE OXA-932 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5221 UPDATE OXA-935 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5222 UPDATE OXA-937 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5223 UPDATE OXA-938 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5224 UPDATE OXA-939 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5225 UPDATE OXA-940 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5226 UPDATE OXA-941 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5227 UPDATE OXA-942 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5228 UPDATE OXA-943 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5229 UPDATE OXA-945 OXA-143-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5230 UPDATE OXA-946 OXA-679-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5231 UPDATE OXA-947 OXA-679-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5232 UPDATE OXA-948 OXA-679-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5233 UPDATE OXA-949 OXA-679-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5633 UPDATE PST-1 PST beta-lactamase; carbapenem; antibiotic inactivation; model_sequences "UPDATED NCBI_taxonomy_name with Stutzerimonas stutzeri " 5668 UPDATE TEM-98 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 5669 UPDATE TEM-99 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 5689 UPDATE VHH-1 VHH beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36981 " 5690 UPDATE VHW-1 VHW beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36981 " 5712 UPDATE VIM-63 VIM beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35976 " 5723 UPDATE YEM-1 YEM beta-lactamase; carbapenem; antibiotic inactivation; ARO_category "DELETED 36309 " 5726 UPDATE norC major facilitator superfamily (MFS) antibiotic efflux pump; fluoroquinolone antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 35954 " 5879 UPDATE MCR-10.5 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5880 UPDATE MCR-10.3 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5727 UPDATE mdeA major facilitator superfamily (MFS) antibiotic efflux pump; fluoroquinolone antibiotic; aminoglycoside antibiotic; penicillin beta-lactam; tetracycline antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 35954 " 5728 UPDATE sepA small multidrug resistance (SMR) antibiotic efflux pump; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 35963 " 5729 UPDATE sdrM major facilitator superfamily (MFS) antibiotic efflux pump; fluoroquinolone antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 37006 " 5730 UPDATE qacJ small multidrug resistance (SMR) antibiotic efflux pump; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 40514 " 5731 UPDATE qacG small multidrug resistance (SMR) antibiotic efflux pump; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 40514 " 5733 UPDATE fexB major facilitator superfamily (MFS) antibiotic efflux pump; phenicol antibiotic; antibiotic efflux; ARO_category "DELETED 36600 " 5736 UPDATE NDM-33 NDM beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35954 " 2823 UPDATE Mycoplasmopsis fermentans 23S rRNA with mutation conferring resistance to macrolide antibiotics 23S rRNA with mutation conferring resistance to macrolide antibiotics; macrolide antibiotic; antibiotic target alteration; ARO_category "DELETED 35925 " 2891 UPDATE Alkalihalobacillus clausii chloramphenicol acetyltransferase chloramphenicol acetyltransferase (CAT); phenicol antibiotic; antibiotic inactivation; ARO_category "DELETED 36524 " 1524 UPDATE Limosilactobacillus reuteri cat-TC chloramphenicol acetyltransferase (CAT); phenicol antibiotic; antibiotic inactivation; ARO_category "DELETED 36521 " 89 UPDATE vanY gene in vanA cluster vanY; glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 97 UPDATE vanXY gene in vanC cluster glycopeptide resistance gene cluster; vanXY; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 178 UPDATE vanH gene in vanA cluster vanH; glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 217 UPDATE vanX gene in vanA cluster vanX; glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 499 UPDATE vanS gene in vanB cluster vanS; glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 626 UPDATE vanH gene in vanB cluster vanH; glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 691 UPDATE vanR gene in vanE cluster glycopeptide resistance gene cluster; vanR; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 734 UPDATE vanT gene in vanC cluster glycopeptide resistance gene cluster; vanT; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 826 UPDATE TolC ATP-binding cassette (ABC) antibiotic efflux pump; major facilitator superfamily (MFS) antibiotic efflux pump; resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; fluoroquinolone antibiotic; aminoglycoside antibiotic; carbapenem; cephalosporin; glycylcycline; penicillin beta-lactam; tetracycline antibiotic; peptide antibiotic; aminocoumarin antibiotic; rifamycin antibiotic; phenicol antibiotic; disinfecting agents and antiseptics; nonribosomal peptide antibiotics; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35925 " 995 UPDATE MexG resistance-nodulation-cell division (RND) antibiotic efflux pump; fluoroquinolone antibiotic; tetracycline antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 0010004 UPDATED category_aro_cvterm_id with 36005 UPDATED category_aro_name with resistance-nodulation-cell division (RND) antibiotic efflux pump UPDATED category_aro_description with Directed pumping of antibiotic out of a cell to confer resistance. Resistance-nodulation-division (RND) proteins are found in both prokaryotic and eukaryotic cells and have diverse substrate specificities and physiological roles. However, there are relatively few RND transporters and they are secondary transporters, energized not by ATP binding/hydrolysis but by proton movement down the transmembrane electrochemical gradient. UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_accession with 0000001 UPDATED category_aro_cvterm_id with 35920 UPDATED category_aro_name with fluoroquinolone antibiotic UPDATED category_aro_description with The fluoroquinolones are a family of synthetic broad-spectrum antibiotics that are 4-quinolone-3-carboxylates. These compounds interact with topoisomerase II (DNA gyrase) to disrupt bacterial DNA replication, damage DNA, and cause cell death. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000050 UPDATED category_aro_cvterm_id with 36189 UPDATED category_aro_name with tetracycline antibiotic UPDATED category_aro_description with These antibiotics are derived from tetracycline, a polyketide antibiotic that inhibits the 30S subunit of bacterial ribosomes. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3005386 UPDATED category_aro_cvterm_id with 43746 UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. UPDATED category_aro_class_name with Drug Class DELETED 36298 " 1036 UPDATE vanW gene in vanB cluster vanW; glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 1144 UPDATE vgbB streptogramin vgb lyase; streptogramin antibiotic; antibiotic inactivation; ARO_category "DELETED 36722 " 1308 UPDATE vanT gene in vanE cluster glycopeptide resistance gene cluster; vanT; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 1453 UPDATE vanY gene in vanD cluster vanY; glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 1594 UPDATE vgbA streptogramin vgb lyase; streptogramin antibiotic; antibiotic inactivation; ARO_category "DELETED 36722 " 1647 UPDATE MexI resistance-nodulation-cell division (RND) antibiotic efflux pump; fluoroquinolone antibiotic; tetracycline antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3000050 UPDATED category_aro_cvterm_id with 36189 UPDATED category_aro_name with tetracycline antibiotic UPDATED category_aro_description with These antibiotics are derived from tetracycline, a polyketide antibiotic that inhibits the 30S subunit of bacterial ribosomes. UPDATED category_aro_class_name with Drug Class DELETED 35963 " 1669 UPDATE vanZ gene in vanF cluster vanZ; glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 1920 UPDATE vanS gene in vanF cluster vanS; glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 3 UPDATE Escherichia coli ompF with mutation conferring resistance to beta-lactam antibiotics General Bacterial Porin with reduced permeability to beta-lactams; monobactam; carbapenem; cephalosporin; penicillin beta-lactam; reduced permeability to antibiotic; ARO_category "DELETED 35976 " 2148 UPDATE Ureaplasma urealyticum gyrB conferring resistance to fluoroquinolones fluoroquinolone resistant gyrB; fluoroquinolone antibiotic; antibiotic target alteration; ARO_category "DELETED 35942 " 2086 UPDATE Escherichia coli 16S rRNA (rrnB) mutation conferring resistance to tetracycline 16S rRNA with mutation conferring resistance to tetracycline derivatives; tetracycline antibiotic; antibiotic target alteration; ARO_category "DELETED 35968 " 2203 UPDATE MCR-1.1 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 3453 UPDATE OXA-289 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 2223 UPDATE MexZ resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; macrolide antibiotic; fluoroquinolone antibiotic; aminoglycoside antibiotic; carbapenem; cephalosporin; penicillin beta-lactam; tetracycline antibiotic; phenicol antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35925 " 2269 UPDATE Escherichia coli nfsB with mutation conferring resistance to nitrofurantoin Antibiotic resistant nfsB; nitrofuran antibiotic; antibiotic target alteration; ARO_category "DELETED 35992 " 2278 UPDATE Bifidobacterium bifidum ileS conferring resistance to mupirocin antibiotic-resistant isoleucyl-tRNA synthetase (ileS); mupirocin-like antibiotic; antibiotic target alteration; ARO_category "DELETED 36693 " 2254 UPDATE Staphylococcus aureus fusA with mutation conferring resistance to fusidic acid antibiotic resistant fusA; fusidane antibiotic; antibiotic target alteration; model_param; ARO_category "UPDATED param_type with single resistance variant UPDATED param_description with A sequence change where, compared to a reference sequence, one amino acid is replaced by one other amino acid that is associated with elevated resistance to antibiotic(s) relative to wild type. Format is given as [wild-type][position][mutation], e.g. R184Q or R447Var where Var represents any possible substitution. UPDATED param_type_id with 36301 UPDATED 3355 with L461F UPDATED 3358 with Q115L UPDATED 3374 with R464H UPDATED 3375 with R464H UPDATED 3388 with R464H DELETED 37139 " 2256 UPDATE Staphylococcus aureus fusE with mutation conferring resistance to fusidic acid antibiotic resistant fusE; fusidane antibiotic; antibiotic target alteration; ARO_category "DELETED 37139 " 2272 UPDATE Enterococcus faecalis cls with mutation conferring resistance to daptomycin daptomycin resistant cls; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35985 " 2271 UPDATE Staphylococcus aureus mupB conferring resistance to mupirocin antibiotic-resistant isoleucyl-tRNA synthetase (ileS); mupirocin-like antibiotic; antibiotic target alteration; ARO_category "DELETED 36693 " 2270 UPDATE Staphylococcus aureus mupA conferring resistance to mupirocin antibiotic-resistant isoleucyl-tRNA synthetase (ileS); mupirocin-like antibiotic; antibiotic target alteration; ARO_category "DELETED 36693 " 2080 UPDATE Escherichia coli 16S rRNA (rrsH) mutation conferring resistance to spectinomycin 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35957 " 2300 UPDATE Acinetobacter baumannii ampC beta-lactamase ampC-type beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35976 " 2304 UPDATE Staphylococcus aureus agrA with mutation conferring resistance to daptomycin daptomycin resistant agrA; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35985 " 3330 UPDATE Mycoplasma genitalium gyrA mutation confers resistance to fluoroquinolones fluoroquinolone resistant gyrA; fluoroquinolone antibiotic; nybomycin-like antibiotic; antibiotic target alteration; model_sequences; ARO_category "UPDATED NCBI_taxonomy_name with Mycoplasmoides genitalium G37 UPDATED category_aro_accession with 3007157 UPDATED category_aro_cvterm_id with 45739 UPDATED category_aro_name with nybomycin-like antibiotic UPDATED category_aro_description with A group of antibiotics including nybomycin and its derivatives. UPDATED category_aro_class_name with Drug Class DELETED 35991 " 2405 UPDATE Neisseria gonorrhoeae parC conferring resistance to fluoroquinolones fluoroquinolone resistant parC; fluoroquinolone antibiotic; antibiotic target alteration; ARO_category "DELETED 35954 " 5881 UPDATE MCR-10.4 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5882 UPDATE MCR-10.2 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 2445 UPDATE Erm(44)v Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35925 " 2424 UPDATE YojI ATP-binding cassette (ABC) antibiotic efflux pump; peptide antibiotic; ribosomally synthesized and post-translationally modified peptide antibiotics; lasso peptide antibiotics; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009656 UPDATED category_aro_cvterm_id with 48527 UPDATED category_aro_name with ribosomally synthesized and post-translationally modified peptide antibiotics UPDATED category_aro_description with Ribosomally synthesized and post-translationally modified peptides (RiPPs) are a large and structurally diverse superfamily of biologically active natural products. They are generated via ribosomal translation of a peptide-encoding gene and subsequent processing of the precursor peptide by dedicated enzymes that introduce a variety of post-translational modifications, including intramolecular cyclization, dehydration and formation of heterocycles. The modifications set the 3D shape of the peptides, facilitate interaction with the target and protect them from degradation by cellular peptidases. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009658 UPDATED category_aro_cvterm_id with 48529 UPDATED category_aro_name with lasso peptide antibiotics UPDATED category_aro_description with Lasso peptides are ribosomally synthesized and post-translationally modified peptides (RiPPs) characterized by a threaded lariat-like structure, in which the C-terminal peptide tail is trapped within an N-terminal macrolactam ring. This unique topology contributes to their exceptional stability and diverse biological activities. Many lasso peptides exhibit antibacterial activity by targeting essential cellular processes, including transcription and proteolysis, although their molecular targets are highly diverse. UPDATED category_aro_class_name with Drug Class DELETED 40721 " 2482 UPDATE Chlamydomonas reinhardtii 16S rRNA (rrnS) mutation conferring resistance to streptomycin 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35958 " 2518 UPDATE tetB(58) major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 3403 UPDATE Mycobacterium tuberculosis rpsA mutations conferring resistance to pyrazinamide pyrazinamide resistant rpsA; pyrazine antibiotic; antibiotic target alteration; model_param; ARO_category "UPDATED param_type with single resistance variant UPDATED param_description with A sequence change where, compared to a reference sequence, one amino acid is replaced by one other amino acid that is associated with elevated resistance to antibiotic(s) relative to wild type. Format is given as [wild-type][position][mutation], e.g. R184Q or R447Var where Var represents any possible substitution. UPDATED param_type_id with 36301 UPDATED 9722 with A440T UPDATED 18560 with D123A DELETED 39997 " 2287 UPDATE Mycolicibacterium smegmatis ndh with mutation conferring resistance to isoniazid antibiotic resistant ndh; isoniazid-like antibiotic; antibiotic target alteration; ARO_category "DELETED 36659 " 2666 UPDATE Escherichia coli fabI mutations conferring resistance to isoniazid and triclosan antibiotic resistant fabI; disinfecting agents and antiseptics; isoniazid-like antibiotic; antibiotic target alteration; ARO_category "DELETED 37250 " 2681 UPDATE Escherichia coli fabG mutations conferring resistance to triclosan antibiotic resistant fabG; disinfecting agents and antiseptics; antibiotic target alteration; ARO_category "DELETED 37250 " 5943 UPDATE TEM-247 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 2746 UPDATE AcrAD-TolC resistance-nodulation-cell division (RND) antibiotic efflux pump; aminoglycoside antibiotic; antibiotic efflux; ARO_category "DELETED 35924 " 2778 UPDATE MCR-2.1 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 2789 UPDATE Escherichia coli mipA MipA-interacting Protein; fluoroquinolone antibiotic; aminoglycoside antibiotic; reduced permeability to antibiotic; resistance by absence; ARO_category "DELETED 35958 " 2795 UPDATE MCR-3.1 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 2818 UPDATE Streptomyces ambofaciens 23S rRNA with mutation conferring resistance to macrolide antibiotics 23S rRNA with mutation conferring resistance to macrolide antibiotics; macrolide antibiotic; antibiotic target alteration; ARO_category "DELETED 36295 " 2848 UPDATE MCR-4.1 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 2849 UPDATE MCR-5.1 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 3705 UPDATE Mycobacterium tuberculosis clpC1 with mutation conferring resistance to pyrazinamide pyrazinamide resistant clpC1; pyrazine antibiotic; antibiotic target alteration; ARO_category "DELETED 39997 " 2914 UPDATE Bifidobacterium adolescentis rpoB mutants conferring resistance to rifampicin rifamycin-resistant beta-subunit of RNA polymerase (rpoB); rifamycin antibiotic; antibiotic target alteration; antibiotic target replacement; ARO_category "DELETED 36308 " 3144 UPDATE MCR-8.1 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 3739 UPDATE Mycobacterium tuberculosis fabG1 mutation conferring resistance to ethionamide ethionamide resistant fabG1; thioamide antibiotic; antibiotic target alteration; ARO_category "DELETED 40067 " 3714 UPDATE Mycobacterium tuberculosis gpsI with mutations conferring resistance to pyrazinamide pyrazinamide resistant gpsI; pyrazine antibiotic; antibiotic target alteration; ARO_category "DELETED 39997 " 3296 UPDATE erm(45) Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35925 " 5883 UPDATE MCR-3.17 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 3268 UPDATE Clostridioides difficile gyrB conferring resistance to fluoroquinolones fluoroquinolone resistant gyrB; fluoroquinolone antibiotic; antibiotic target alteration; ARO_category "DELETED 35954 " 3749 UPDATE Neisseria gonorrhoeae mtrC with mutation conferring resistance to azithromycin resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; antibiotic efflux; ARO_category "DELETED 35925 " 3753 UPDATE TxR ATP-binding cassette (ABC) antibiotic efflux pump; antibiotic efflux regulatory protein; tetracycline antibiotic; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35968 " 3895 UPDATE Mycobacterium tuberculosis ethA mutations conferring resistance to perchlozone perchlozone resistant ethA; thiosemicarbazone antibiotic; antibiotic target alteration; ARO_category "DELETED 43528 " 5737 UPDATE salB sal-type ABC-F protein; lincosamide antibiotic; streptogramin antibiotic; pleuromutilin antibiotic; antibiotic target protection; ARO_category "DELETED 35964 " 5738 UPDATE salC sal-type ABC-F protein; lincosamide antibiotic; streptogramin antibiotic; pleuromutilin antibiotic; antibiotic target protection; ARO_category "DELETED 35964 " 5739 UPDATE salD sal-type ABC-F protein; lincosamide antibiotic; streptogramin antibiotic; pleuromutilin antibiotic; antibiotic target protection; ARO_category "DELETED 35964 " 5740 UPDATE salE sal-type ABC-F protein; lincosamide antibiotic; streptogramin antibiotic; pleuromutilin antibiotic; antibiotic target protection; ARO_category "DELETED 37015 " 229 UPDATE vanTm gene in vanL cluster glycopeptide resistance gene cluster; vanT; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 298 UPDATE vanY gene in vanG cluster vanY; glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 390 UPDATE vanS gene in vanG cluster vanS; glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 465 UPDATE vanS gene in vanO cluster vanS; glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 518 UPDATE vanXY gene in vanN cluster glycopeptide resistance gene cluster; vanXY; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 744 UPDATE vanS gene in vanL cluster vanS; glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 752 UPDATE vanR gene in vanM cluster glycopeptide resistance gene cluster; vanR; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 943 UPDATE vanU gene in vanG cluster glycopeptide resistance gene cluster; vanU; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 1033 UPDATE vanS gene in vanN cluster vanS; glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 1219 UPDATE vanR gene in vanN cluster glycopeptide resistance gene cluster; vanR; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 1328 UPDATE vanS gene in vanM cluster vanS; glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 1510 UPDATE vanTr gene in vanL cluster glycopeptide resistance gene cluster; vanT; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 1622 UPDATE vanW gene in vanG cluster vanW; glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 1689 UPDATE vanR gene in vanO cluster glycopeptide resistance gene cluster; vanR; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 1724 UPDATE vanH gene in vanM cluster vanH; glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 1872 UPDATE vanXY gene in vanL cluster glycopeptide resistance gene cluster; vanXY; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 1983 UPDATE vanT gene in vanN cluster glycopeptide resistance gene cluster; vanT; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 2242 UPDATE vanW gene in vanI cluster vanW; glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 2245 UPDATE vanK gene in vanI cluster glycopeptide resistance gene cluster; vanK; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 5912 UPDATE QnrB80 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 5742 UPDATE Erm(52) Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35983 " 5743 UPDATE msr(G) msr-type ABC-F protein; macrolide antibiotic; streptogramin antibiotic; antibiotic target protection; model_sequences; ARO_category "UPDATED NCBI_taxonomy_name with Macrococcoides canis DELETED 35925 " 5744 UPDATE msr(I) msr-type ABC-F protein; macrolide antibiotic; streptogramin antibiotic; phosphonic acid antibiotic; antibiotic target protection; ARO_category "DELETED 35944 " 5746 UPDATE Erm(51) Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35925 " 5749 UPDATE mreA major facilitator superfamily (MFS) antibiotic efflux pump; macrolide antibiotic; antibiotic efflux; ARO_category "DELETED 35925 " 5751 UPDATE OXA-290 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 5752 UPDATE Helicobacter pylori gyrA conferring resistance to fluoroquinolones fluoroquinolone resistant gyrA; fluoroquinolone antibiotic; nybomycin-like antibiotic; antibiotic target alteration; model_param; ARO_category "UPDATED 20523 with A88V DELETED 12352 UPDATED 20523 with A88V UPDATED 12367 with V172I DELETED 12352 UPDATED 20523 with A88V DELETED 12352 DELETED 12368 UPDATED category_aro_accession with 3007157 UPDATED category_aro_cvterm_id with 45739 UPDATED category_aro_name with nybomycin-like antibiotic UPDATED category_aro_description with A group of antibiotics including nybomycin and its derivatives. UPDATED category_aro_class_name with Drug Class DELETED 35988 " 5753 UPDATE Helicobacter pylori gyrB conferring resistance to fluoroquinolones fluoroquinolone resistant gyrB; fluoroquinolone antibiotic; antibiotic target alteration; model_param; ARO_category "UPDATED param_type with single resistance variant UPDATED param_description with A sequence change where, compared to a reference sequence, one amino acid is replaced by one other amino acid that is associated with elevated resistance to antibiotic(s) relative to wild type. Format is given as [wild-type][position][mutation], e.g. R184Q or R447Var where Var represents any possible substitution. UPDATED param_type_id with 36301 UPDATED 12373 with E463K UPDATED 12374 with E463K UPDATED 12375 with E463K UPDATED 12377 with E463K DELETED 35988 " 5779 UPDATE nimD nitroimidazole reductase; nitroimidazole antibiotic; antibiotic inactivation; ARO_category "DELETED 37033 " 5756 UPDATE Helicobacter pylori pbp3 conferring resistance to amoxicillin penicillin-binding protein with mutation conferring resistance to beta-lactam antibiotics; monobactam; cephalosporin; penicillin beta-lactam; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 0000004 UPDATED category_aro_cvterm_id with 35923 UPDATED category_aro_name with monobactam UPDATED category_aro_description with Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_name with penicillin-binding protein with mutation conferring resistance to beta-lactam antibiotics DELETED 35981 " 5757 UPDATE Helicobacter pylori pbp2 mutants conferring resistance to amoxicillin penicillin-binding protein with mutation conferring resistance to beta-lactam antibiotics; monobactam; cephalosporin; penicillin beta-lactam; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 0000004 UPDATED category_aro_cvterm_id with 35923 UPDATED category_aro_name with monobactam UPDATED category_aro_description with Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_name with penicillin-binding protein with mutation conferring resistance to beta-lactam antibiotics DELETED 35981 " 5758 UPDATE Helicobacter pylori pbp1 mutants conferring resistance to amoxicillin penicillin-binding protein with mutation conferring resistance to beta-lactam antibiotics; monobactam; cephalosporin; penicillin beta-lactam; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 0000004 UPDATED category_aro_cvterm_id with 35923 UPDATED category_aro_name with monobactam UPDATED category_aro_description with Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_name with penicillin-binding protein with mutation conferring resistance to beta-lactam antibiotics DELETED 35981 " 5759 UPDATE Helicobacter pylori frxA mutation conferring resistance to metronidazole Antibiotic resistant Helicobacter pylori nitroreductase; nitroimidazole antibiotic; antibiotic target alteration; model_param; ARO_category "UPDATED 12437 with S402G UPDATED 12455 with S402G UPDATED 12462 with S402G UPDATED 12463 with S402G UPDATED 12464 with S402G DELETED 12468 DELETED 12468 DELETED 12468 DELETED 37033 " 5761 UPDATE VAM-1 VAM beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35979 " 5762 UPDATE Erm(50) Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35946 " 4069 UPDATE OXA-647 OXA-134-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5750 UPDATE Helicobacter pylori rpoB mutation conferring resistance to rifampicin rifamycin-resistant beta-subunit of RNA polymerase (rpoB); fluoroquinolone antibiotic; rifamycin antibiotic; antibiotic target alteration; antibiotic target replacement; ARO_category "DELETED 35988 " 5763 UPDATE Neisseria gonorrhoeae rpld 50S rRNA with mutation conferring resistance to macrolide antibiotics; macrolide antibiotic; antibiotic target alteration; ARO_category "DELETED 36297 " 5765 UPDATE FosY fosfomycin thiol transferase; phosphonic acid antibiotic; antibiotic inactivation; ARO_category "DELETED 35944 " 5766 UPDATE MCR-1.33 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5767 UPDATE Bacillus subtilis rpoB mutants conferring resistance to rifampin rifamycin-resistant beta-subunit of RNA polymerase (rpoB); rifamycin antibiotic; antibiotic target alteration; antibiotic target replacement; ARO_category "DELETED 36308 " 5768 UPDATE cph capreomycin phosphotransferase; aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 40875 " 5748 UPDATE mef(J) major facilitator superfamily (MFS) antibiotic efflux pump; macrolide antibiotic; antibiotic efflux; ARO_category "DELETED 36298 " 5747 UPDATE mef(H) major facilitator superfamily (MFS) antibiotic efflux pump; macrolide antibiotic; antibiotic efflux; ARO_category "DELETED 36298 " 3847 UPDATE lsaD lsa-type ABC-F protein; lincosamide antibiotic; streptogramin antibiotic; pleuromutilin antibiotic; antibiotic target protection; ARO_category "DELETED 35964 " 5769 UPDATE PRC-1 PRC beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35975 " 5772 UPDATE FosM1 fosfomycin thiol transferase; phosphonic acid antibiotic; antibiotic inactivation; ARO_category "DELETED 35944 " 5773 UPDATE FosM2 fosfomycin thiol transferase; phosphonic acid antibiotic; antibiotic inactivation; ARO_category "DELETED 35944 " 5774 UPDATE FosM3 fosfomycin thiol transferase; phosphonic acid antibiotic; antibiotic inactivation; ARO_category "DELETED 35944 " 5777 UPDATE nimA nitroimidazole reductase; nitroimidazole antibiotic; antibiotic inactivation; ARO_category "DELETED 37033 " 5778 UPDATE nimC nitroimidazole reductase; nitroimidazole antibiotic; antibiotic inactivation; ARO_category "DELETED 37033 " 5780 UPDATE nimE nitroimidazole reductase; nitroimidazole antibiotic; antibiotic inactivation; ARO_category "DELETED 37033 " 5916 UPDATE LnuH lincosamide nucleotidyltransferase (LNU); lincosamide antibiotic; antibiotic inactivation; ARO_category "DELETED 35964 " 5781 UPDATE nimF nitroimidazole reductase; nitroimidazole antibiotic; antibiotic inactivation; ARO_category "DELETED 37033 " 5782 UPDATE nimG nitroimidazole reductase; nitroimidazole antibiotic; antibiotic inactivation; ARO_category "DELETED 37033 " 5783 UPDATE nimH nitroimidazole reductase; nitroimidazole antibiotic; antibiotic inactivation; ARO_category "DELETED 37033 " 5784 UPDATE nimI nitroimidazole reductase; nitroimidazole antibiotic; antibiotic inactivation; ARO_category "DELETED 37033 " 5785 UPDATE nimJ nitroimidazole reductase; nitroimidazole antibiotic; antibiotic inactivation; ARO_category "DELETED 37033 " 5786 UPDATE nimK nitroimidazole reductase; nitroimidazole antibiotic; antibiotic inactivation; ARO_category "DELETED 37033 " 5787 UPDATE nimB nitroimidazole reductase; nitroimidazole antibiotic; antibiotic inactivation; ARO_category "DELETED 37033 " 5788 UPDATE crxA subclass B1 Bacteroides xylanisolvens crx beta-lactamase; carbapenem; antibiotic inactivation; ARO_category "DELETED 35990 " 5789 UPDATE tet(O/32/O) tetracycline-resistant ribosomal protection protein; tetracycline antibiotic; antibiotic target protection; ARO_category "DELETED 35968 " 5790 UPDATE tet(O/M/O) tetracycline-resistant ribosomal protection protein; tetracycline antibiotic; antibiotic target protection; ARO_category "DELETED 35968 " 5791 UPDATE tet(O/W) tetracycline-resistant ribosomal protection protein; tetracycline antibiotic; antibiotic target protection; ARO_category "DELETED 35968 " 5792 UPDATE tet(O/W/32/O) tetracycline-resistant ribosomal protection protein; tetracycline antibiotic; antibiotic target protection; ARO_category "DELETED 35968 " 5793 UPDATE tet(O/W/O) tetracycline-resistant ribosomal protection protein; tetracycline antibiotic; antibiotic target protection; ARO_category "DELETED 35968 " 5794 UPDATE tet(W/32/O) tetracycline-resistant ribosomal protection protein; tetracycline antibiotic; antibiotic target protection; ARO_category "DELETED 35968 " 3308 UPDATE tet(47) tetracycline inactivation enzyme; tetracycline antibiotic; antibiotic inactivation; ARO_category "DELETED 35968 " 3401 UPDATE tet(X3) tetracycline inactivation enzyme; glycylcycline; tetracycline antibiotic; antibiotic inactivation; ARO_category "DELETED 35949 " 3797 UPDATE tet(X6) tetracycline inactivation enzyme; tetracycline antibiotic; antibiotic inactivation; ARO_category "DELETED 35968 " 3888 UPDATE tet(X1) tetracycline inactivation enzyme; tetracycline antibiotic; antibiotic inactivation; ARO_category "DELETED 35968 " 1273 UPDATE Streptomyces rimosus otr(A) tetracycline-resistant ribosomal protection protein; tetracycline antibiotic; antibiotic target protection; ARO_category "DELETED 37012 " 5797 UPDATE Streptomyces lividans otr(A) tetracycline-resistant ribosomal protection protein; tetracycline antibiotic; antibiotic target protection; ARO_category "DELETED 35968 " 5798 UPDATE mcr-10.1 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5799 UPDATE MAB class A Mycobacterium abscessus beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 5884 UPDATE MCR-1.15 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5885 UPDATE MCR-1.26 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5886 UPDATE MCR-5.4 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5800 UPDATE blaC class A Mycobacterium tuberculosis bla beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35927 " 5801 UPDATE Mycobacterium tuberculosis Rv1258c mutations confer resistance to ethambutol and capreomycin multidrug resistant Rv1258c; aminoglycoside antibiotic; polyamine antibiotic; isoniazid-like antibiotic; pyrazine antibiotic; antibiotic target alteration; ARO_category "DELETED 36636 " 5802 UPDATE Mycobacterium tuberculosis Rv1258c mutations confer resistance to pyrazinamide, isoniazid, and streptomycin multidrug resistant Rv1258c; aminoglycoside antibiotic; polyamine antibiotic; isoniazid-like antibiotic; pyrazine antibiotic; antibiotic target alteration; ARO_category "DELETED 35958 " 3710 UPDATE Mycobacterium tuberculosis Rv1258c mutations confer resistance to streptomycin streptomycin resistant Rv1258c; aminoglycoside antibiotic; antibiotic target alteration; model_param; ARO_category "UPDATED 9851 with S292L DELETED 35958 " 5755 UPDATE Helicobacter pylori rdxA mutation conferring resistance to metronidazole Antibiotic resistant Helicobacter pylori nitroreductase; nitroimidazole antibiotic; antibiotic target alteration; model_param; ARO_category "UPDATED 12411 with S292L UPDATED 12412 with S292L UPDATED 12438 with S292L UPDATED 12482 with S292L UPDATED 13116 with S292L UPDATED 12436 with D59S UPDATED 12479 with D59S UPDATED 12480 with D59S UPDATED 12481 with D59S UPDATED 12483 with D59S UPDATED 12484 with D59S UPDATED 12478 with D59S UPDATED 12485 with D59S DELETED 12400 DELETED 12400 DELETED 12400 DELETED 37033 " 5804 UPDATE vanH gene in vanP cluster vanH; glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 5805 UPDATE vanP glycopeptide resistance gene cluster; Van ligase; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 5806 UPDATE vanX gene in vanP cluster vanX; glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 5807 UPDATE vanR gene in vanP cluster glycopeptide resistance gene cluster; vanR; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 5808 UPDATE vanS gene in vanP cluster vanS; glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 1814 UPDATE AAC(6')-Ie-APH(2'')-Ia bifunctional protein aminoglycoside bifunctional resistance protein; aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 5809 UPDATE glycopeptide resistance gene cluster vanP glycopeptide resistance gene cluster; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; model_param; ARO_category "UPDATED 12653 with D59S UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 2092 UPDATE Enterobacter aerogenes acrR with mutation conferring multidrug antibiotic resistance resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; fluoroquinolone antibiotic; cephalosporin; glycylcycline; penicillin beta-lactam; tetracycline antibiotic; rifamycin antibiotic; phenicol antibiotic; disinfecting agents and antiseptics; antibiotic target alteration; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35949 " 5811 UPDATE KPC-123 KPC beta-lactamase; monobactam; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35976 " 5812 UPDATE PAM-1 PAM beta-lactamase; carbapenem; cephalosporin; antibiotic inactivation; ARO_category "DELETED 35977 " 5813 UPDATE PAM-2 PAM beta-lactamase; carbapenem; cephalosporin; antibiotic inactivation; ARO_category "DELETED 35977 " 5817 UPDATE AAC(6')-Iap AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 5818 UPDATE KBL-1 KBL beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35981 " 5820 UPDATE Streptomyces venezuelae rox rifampin monooxygenase; rifamycin antibiotic; antibiotic inactivation; ARO_category "DELETED 36308 " 5821 UPDATE Nocardia farcinica rox rifampin monooxygenase; rifamycin antibiotic; antibiotic inactivation; ARO_category "DELETED 36308 " 5832 UPDATE MCR-8.3 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5816 UPDATE Klebsiella pneumoniae mutant PhoQ conferring resistance to colistin ATP-binding cassette (ABC) antibiotic efflux pump; pmr phosphoethanolamine transferase; transmembrane protein conferring colistin resistance; antibiotic efflux regulatory protein; macrolide antibiotic; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; antibiotic efflux; resistance by absence; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35925 " 5819 UPDATE HelR helicase-like RNA polymerase protection protein; rifamycin antibiotic; antibiotic target protection; ARO_category "DELETED 36308 " 5833 UPDATE MCR-8.4 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5834 UPDATE MCR-8.2 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5835 UPDATE MCR-1.34 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5836 UPDATE MCR-4.6 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5837 UPDATE MCR-1.27 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5838 UPDATE MCR-1.18 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5839 UPDATE MCR-1.23 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5840 UPDATE MCR-1.20 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5841 UPDATE MCR-1.28 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5842 UPDATE MCR-1.21 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5843 UPDATE MCR-1.16 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5844 UPDATE MCR-1.22 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5845 UPDATE MCR-1.19 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5846 UPDATE MCR-1.29 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5847 UPDATE MCR-1.30 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5848 UPDATE MCR-1.24 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5849 UPDATE MCR-1.17 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5850 UPDATE MCR-1.31 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5851 UPDATE MCR-1.14 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5852 UPDATE MCR-1.25 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5853 UPDATE MCR-3.33 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5854 UPDATE MCR-3.14 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5855 UPDATE MCR-3.37 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5856 UPDATE MCR-3.38 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5857 UPDATE MCR-3.15 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5858 UPDATE MCR-3.27 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5859 UPDATE MCR-3.32 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5860 UPDATE MCR-3.31 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5861 UPDATE MCR-3.23 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5862 UPDATE MCR-3.36 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5863 UPDATE MCR-3.25 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5864 UPDATE MCR-3.22 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5865 UPDATE MCR-3.16 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5866 UPDATE MCR-3.26 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5867 UPDATE MCR-3.21 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5868 UPDATE MCR-3.18 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5869 UPDATE MCR-3.40 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5870 UPDATE MCR-3.24 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5871 UPDATE MCR-3.20 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5872 UPDATE MCR-3.35 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5873 UPDATE MCR-3.34 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5874 UPDATE MCR-3.13 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5875 UPDATE MCR-3.28 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5876 UPDATE MCR-3.39 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5877 UPDATE MCR-3.29 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5878 UPDATE MCR-3.19 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5887 UPDATE MCR-5.3 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5888 UPDATE MCR-2.4 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5889 UPDATE MCR-2.3 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5890 UPDATE MCR-2.8 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5891 UPDATE MCR-2.5 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5892 UPDATE MCR-2.7 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5893 UPDATE MCR-2.6 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5894 UPDATE MCR-1.32 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5895 UPDATE FosXCC fosfomycin thiol transferase; phosphonic acid antibiotic; antibiotic inactivation; ARO_category "DELETED 35944 " 5896 UPDATE FosG fosfomycin thiol transferase; phosphonic acid antibiotic; antibiotic inactivation; ARO_category "DELETED 35944 " 5897 UPDATE FosH fosfomycin thiol transferase; phosphonic acid antibiotic; antibiotic inactivation; ARO_category "DELETED 35944 " 5898 UPDATE FosI fosfomycin thiol transferase; phosphonic acid antibiotic; antibiotic inactivation; ARO_category "DELETED 35944 " 5899 UPDATE FosA8 fosfomycin thiol transferase; phosphonic acid antibiotic; antibiotic inactivation; ARO_category "DELETED 35944 " 5900 UPDATE FosBx1 fosfomycin thiol transferase; phosphonic acid antibiotic; antibiotic inactivation; ARO_category "DELETED 35944 " 5901 UPDATE PJM-1 PJM beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35927 " 5902 UPDATE KPC-87 KPC beta-lactamase; monobactam; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35990 " 5903 UPDATE KPC-86 KPC beta-lactamase; monobactam; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 5904 UPDATE KPC-95 KPC beta-lactamase; monobactam; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 5905 UPDATE ANT(9)-Ib ANT(9); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35957 " 5906 UPDATE KPC-94 KPC beta-lactamase; monobactam; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 639 UPDATE AAC(3)-IVa AAC(3); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 5907 UPDATE QnrAS quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 5908 UPDATE QnrB39 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 5909 UPDATE QnrB75 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 5910 UPDATE QnrB77 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 5911 UPDATE QnrB78 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 5917 UPDATE Mrx macrolide phosphotransferase (MPH); macrolide antibiotic; antibiotic inactivation; ARO_category "DELETED 35925 " 5918 UPDATE kdpD kdpDE; antibiotic efflux regulatory protein; aminoglycoside antibiotic; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35966 " 5919 UPDATE QnrB76 quinolone resistance protein (qnr); fluoroquinolone antibiotic; antibiotic target protection; ARO_category "DELETED 35954 " 5921 UPDATE leuO major facilitator superfamily (MFS) antibiotic efflux pump; antibiotic efflux regulatory protein; nucleoside antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35963 " 922 UPDATE AAC(6')-30/AAC(6')-Ib' bifunctional protein aminoglycoside bifunctional resistance protein; aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 40942 " 924 UPDATE AAC(6')-I33 AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35932 " 339 UPDATE ANT(3'')-II-AAC(6')-IId bifunctional protein aminoglycoside bifunctional resistance protein; aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 2751 UPDATE APH(3')-IXa APH(3'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35932 " 5923 UPDATE Klebsiella pneumoniae lamB with mutations conferring resistance to ceftazidime-avibactam Sugar Porin (SP); fluoroquinolone antibiotic; cephalosporin; tetracycline antibiotic; reduced permeability to antibiotic; ARO_category "DELETED 35977 " 5924 UPDATE Klebsiella pneumoniae PBP3 mutants conferring resistance to ceftazidime-avibactam penicillin-binding protein with mutation conferring resistance to beta-lactam antibiotics; monobactam; cephalosporin; penicillin beta-lactam; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 0000004 UPDATED category_aro_cvterm_id with 35923 UPDATED category_aro_name with monobactam UPDATED category_aro_description with Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_name with penicillin-binding protein with mutation conferring resistance to beta-lactam antibiotics DELETED 35977 " 5926 UPDATE ThfT ECF transporter S component; sulfonamide antibiotic; resistance by host-dependent nutrient acquisition; ARO_category "DELETED 36468 " 5927 UPDATE almF polymyxin resistance operon; alm glycyl carrier protein; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5928 UPDATE almE polymyxin resistance operon; alm glycyltransferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5914 UPDATE cfrE Cfr-like 23S rRNA methyltransferase; lincosamide antibiotic; streptogramin antibiotic; oxazolidinone antibiotic; phenicol antibiotic; pleuromutilin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Cfr-like 23S rRNA methyltransferase DELETED 36595 " 5975 UPDATE APH(9)-Ic APH(9); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35957 " 5972 UPDATE Mycobacterium tuberculosis 16S rRNA (rrnS) mutation conferring resistance to amikacin 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35966 " 5974 UPDATE Mycobacterium tuberculosis 16S rRNA (rrnS) mutation conferring resistance to kanamycin 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35932 " 5929 UPDATE almEFG polymyxin resistance operon; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; model_param; ARO_category "UPDATED 12842 with a1401g UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5962 UPDATE tet(62) major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 3340 UPDATE AAC(6')-I-43 AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35966 " 5963 UPDATE tet(63) major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 5964 UPDATE tet(64) major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 5965 UPDATE Shigella flexneri acrA resistance-nodulation-cell division (RND) antibiotic efflux pump; fluoroquinolone antibiotic; cephalosporin; glycylcycline; penicillin beta-lactam; tetracycline antibiotic; rifamycin antibiotic; phenicol antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 35949 " 5930 UPDATE KPC-96 KPC beta-lactamase; monobactam; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 5931 UPDATE EBR-5 EBR beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 5932 UPDATE LAQ-1 LAQ beta lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35927 " 5933 UPDATE WUS-1 WUS beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35961 " 5934 UPDATE SSA SSA beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35927 " 5937 UPDATE KPC-100 KPC beta-lactamase; monobactam; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 5941 UPDATE KPC-97 KPC beta-lactamase; monobactam; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 5942 UPDATE KPC-98 KPC beta-lactamase; monobactam; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 5940 UPDATE TEM-246 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 5944 UPDATE TEM-244 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 5945 UPDATE KPC-99 KPC beta-lactamase; monobactam; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 5946 UPDATE TEM-245 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 5947 UPDATE dfrL trimethoprim resistant dihydrofolate reductase dfr; aminoglycoside antibiotic; tetracycline antibiotic; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 35958 " 5948 UPDATE EstT macrolide esterase; macrolide antibiotic; antibiotic inactivation; ARO_category "DELETED 46238 " 3338 UPDATE AAC(6')-I-48 AAC(6'); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35926 " 5958 UPDATE dfrB10 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 5959 UPDATE dfrB11 trimethoprim resistant dihydrofolate reductase dfr; diaminopyrimidine antibiotic; antibiotic target replacement; ARO_category "DELETED 36327 " 5960 UPDATE Mycobacterium abscessus atpE with mutation conferring resistance to bedaquiline antibiotic resistant ATP synthase; diarylquinoline antibiotic; antibiotic target alteration; ARO_category "DELETED 41933 " 5961 UPDATE Pseudomonas aeruginosa ampR with mutation conferring resistance to aztreonam PDC beta-lactamase; ampR transcriptional regulator with mutation conferring resistance to monobactam antibiotics; monobactam; carbapenem; cephalosporin; antibiotic target alteration; antibiotic inactivation; ARO_category "DELETED 36689 " 5967 UPDATE ANT(9)-Ic ANT(9); aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35957 " 3943 UPDATE MCR-3.41 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 2262 UPDATE mef(C) major facilitator superfamily (MFS) antibiotic efflux pump; macrolide antibiotic; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 37012 " 1401 UPDATE mef(E) major facilitator superfamily (MFS) antibiotic efflux pump; macrolide antibiotic; antibiotic efflux; ARO_category "DELETED 35925 " 5745 UPDATE mef(F) major facilitator superfamily (MFS) antibiotic efflux pump; macrolide antibiotic; antibiotic efflux; model_sequences; ARO_category "UPDATED NCBI_taxonomy_name with Macrococcoides canis DELETED 35925 " 5969 UPDATE Bacillus subtilis rpsE mutations conferring resistance to spectinomycin spectinomycin resistant rpsE; aminoglycoside antibiotic; antibiotic target alteration; ARO_category "DELETED 35957 " 5970 UPDATE Streptococcus pyogenes PBP2x conferring resistance to beta-lactam antibiotics penicillin-binding protein with mutation conferring resistance to beta-lactam antibiotics; monobactam; cephalosporin; penicillin beta-lactam; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 0000004 UPDATED category_aro_cvterm_id with 35923 UPDATED category_aro_name with monobactam UPDATED category_aro_description with Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_name with penicillin-binding protein with mutation conferring resistance to beta-lactam antibiotics DELETED 35981 " 5971 UPDATE MCR-4.7 MCR phosphoethanolamine transferase; peptide antibiotic; nonribosomal peptide antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 36966 " 5976 UPDATE Erysipelothrix rhusiopathiae gyrA with mutation conferring resistance to enrofloxacin fluoroquinolone resistant gyrA; fluoroquinolone antibiotic; nybomycin-like antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3007157 UPDATED category_aro_cvterm_id with 45739 UPDATED category_aro_name with nybomycin-like antibiotic UPDATED category_aro_description with A group of antibiotics including nybomycin and its derivatives. UPDATED category_aro_class_name with Drug Class DELETED 45604 " 5977 UPDATE OXA-1038 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5978 UPDATE OXA-1039 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 5979 UPDATE FRI-11 FRI beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35987 " 5981 UPDATE CAE-1 CAE beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35975 " 763 UPDATE catA1 chloramphenicol acetyltransferase (CAT); phenicol antibiotic; antibiotic inactivation; ARO_category "DELETED 36521 " 5982 UPDATE Clostridioides difficile cplR Miscellaneous ABC-F subfamily ATP-binding cassette ribosomal protection proteins; lincosamide antibiotic; streptogramin antibiotic; nucleoside antibiotic; antibiotic target protection; ARO_category "DELETED 35964 " 5983 UPDATE Clostridium perfringes cplR Miscellaneous ABC-F subfamily ATP-binding cassette ribosomal protection proteins; lincosamide antibiotic; streptogramin antibiotic; pleuromutilin antibiotic; antibiotic target protection; ARO_category "DELETED 35964 " 5984 UPDATE Clostridium sporogenes cplR Miscellaneous ABC-F subfamily ATP-binding cassette ribosomal protection proteins; lincosamide antibiotic; antibiotic without defined classification; pleuromutilin antibiotic; antibiotic target protection; ARO_category "DELETED 35983 " 5986 UPDATE PSZ-1 PSZ beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35927 " 5987 UPDATE CDA-1 CDA beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35996 " 5988 UPDATE erm(56) Erm-like 23S rRNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; streptogramin antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_name with Erm-like 23S rRNA methyltransferase UPDATED category_aro_description with Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli numbering) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin. This is called the MLS phenotype. DELETED 35925 " 6065 UPDATE VRA-F ATP-binding cassette (ABC) antibiotic efflux pump; peptide antibiotic; glycopeptide antibiotic; nonribosomal peptide antibiotics; antibiotic efflux; ARO_category "UPDATED category_aro_accession with 3000053 UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3009657 UPDATED category_aro_cvterm_id with 48528 UPDATED category_aro_name with nonribosomal peptide antibiotics UPDATED category_aro_description with Nonribosomal peptide antibiotics are peptide natural products synthesized by nonribosomal peptide synthetases (NRPSs), rather than by the ribosome. They often contain non-proteinogenic amino acids and diverse chemical modifications that contribute to their structural and functional diversity. UPDATED category_aro_class_name with Drug Class DELETED 35947 " 5989 UPDATE putative nickel/cobalt transporter metal transporters with antibiotic efflux; fluoroquinolone antibiotic; aminoglycoside antibiotic; isoniazid-like antibiotic; antibiotic efflux; ARO_category "DELETED 36659 " 6000 UPDATE Mycobacterium tuberculosis ddn mutation conferring resistance to nitroimidazole antibiotics antibiotic resistant Mycobacterium tuberculosis nitroreductase; nitroimidazole antibiotic; antibiotic target alteration; model_param; ARO_category "UPDATED param_type with frameshift mutation UPDATED param_description with A frameshift is a sequence change between the translation initiation (start) and termination (stop) codon where, compared to a reference sequence, translation shifts to another reading frame as caused by nucleotide insertions and deletions. In ARO, these are annotated at the protein level with the first changed most N-terminal wildtype amino acid position. Format is given as [wildtype AA][position]fs, e.g. S531fs where S531 is a frameshifted coordinate beginning with codon 531. Termination may also be denoted as: Ter[position]fs. UPDATED param_type_id with 40494 UPDATED 18760 with M28fs UPDATED 18761 with P5fs UPDATED 18753 with A111fs UPDATED 18754 with R31fs UPDATED 18755 with D108fs UPDATED 18756 with G38fs UPDATED 18757 with L64fs UPDATED 18758 with L90fs UPDATED 18759 with K104fs UPDATED 18760 with L49P UPDATED 18761 with L49P UPDATED 18753 with L49P UPDATED 18754 with L49P UPDATED 18755 with L49P UPDATED 18756 with L49P UPDATED 18757 with L49P UPDATED 18758 with L49P UPDATED 18759 with L49P DELETED 41931 " 6001 UPDATE Rv1877 major facilitator superfamily (MFS) antibiotic efflux pump; fluoroquinolone antibiotic; antibiotic efflux; ARO_category "DELETED 35988 " 6002 UPDATE aadT major facilitator superfamily (MFS) antibiotic efflux pump; macrolide antibiotic; tetracycline antibiotic; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "DELETED 35925 " 6003 UPDATE Clostridioides difficile nimB nitroimidazole reductase; nitroimidazole antibiotic; antibiotic inactivation; ARO_category "DELETED 37033 " 6005 UPDATE IreK Serine/threonine kinases; cephalosporin; reduced permeability to antibiotic; ARO_category "DELETED 35979 " 6006 UPDATE OXA-481 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 6007 UPDATE TEM-103 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35981 " 6008 UPDATE TEM-61 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35977 " 6010 UPDATE OXA-105 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 6004 UPDATE Mycobacterium tuberculosis Rv0678 with mutation conferring resistance to bedaquiline bedaquiline resistant Rv0678; diarylquinoline antibiotic; antibiotic target alteration; model_param; ARO_category "UPDATED param_type with frameshift mutation UPDATED param_description with A frameshift is a sequence change between the translation initiation (start) and termination (stop) codon where, compared to a reference sequence, translation shifts to another reading frame as caused by nucleotide insertions and deletions. In ARO, these are annotated at the protein level with the first changed most N-terminal wildtype amino acid position. Format is given as [wildtype AA][position]fs, e.g. S531fs where S531 is a frameshifted coordinate beginning with codon 531. Termination may also be denoted as: Ter[position]fs. UPDATED param_type_id with 40494 UPDATED 18616 with D47fs UPDATED 18617 with D8fs UPDATED 18619 with C46fs UPDATED 18645 with W42fs UPDATED 18646 with Y145fs UPDATED 18647 with Y157fs UPDATED 18648 with Y92fs UPDATED 18650 with V7fs UPDATED 18601 with R109fs UPDATED 18602 with R123fs UPDATED 18603 with R132fs UPDATED 18604 with R156fs UPDATED 18605 with R30fs UPDATED 18607 with R72fs UPDATED 18608 with R89fs UPDATED 18609 with N148fs UPDATED 18610 with N70fs UPDATED 18611 with N98fs UPDATED 18612 with D116fs UPDATED 18613 with D141fs UPDATED 18614 with D165fs UPDATED 18627 with I67fs UPDATED 18628 with I80fs UPDATED 18629 with L117fs UPDATED 18630 with L125fs UPDATED 18631 with L142fs UPDATED 18632 with L143fs UPDATED 18633 with L32fs UPDATED 18635 with L44fs UPDATED 18636 with L56fs UPDATED 18637 with L83fs UPDATED 18639 with M111fs UPDATED 18634 with L43fs UPDATED 18640 with M146fs UPDATED 18641 with P129fs UPDATED 18642 with P48fs UPDATED 18643 with S68fs UPDATED 18644 with T69fs UPDATED 18638 with M10fs UPDATED 18598 with A110fs UPDATED 18599 with A144fs UPDATED 18600 with A62fs UPDATED 18620 with Q159fs UPDATED 18621 with Q51fs UPDATED 18622 with E49fs UPDATED 18623 with E55fs UPDATED 18624 with G11fs UPDATED 18625 with G41fs UPDATED 18626 with I16fs UPDATED 18616 with M146T UPDATED 18617 with M146T UPDATED 18619 with M146T UPDATED 18645 with T33A UPDATED 18646 with T33A UPDATED 18647 with T33A UPDATED 18648 with T33A UPDATED 18650 with T33A UPDATED 18601 with T33A UPDATED 18602 with T33A UPDATED 18603 with T33A UPDATED 18604 with T33A UPDATED 18605 with T33A UPDATED 18607 with T33A UPDATED 18608 with T33A UPDATED 18609 with T33A UPDATED 18610 with T33A UPDATED 18611 with T33A UPDATED 18612 with T33A UPDATED 18613 with T33A UPDATED 18614 with T33A UPDATED 18627 with T33A UPDATED 18628 with T33A UPDATED 18629 with T33A UPDATED 18630 with T33A UPDATED 18631 with T33A UPDATED 18632 with T33A UPDATED 18633 with T33A UPDATED 18635 with T33A UPDATED 18636 with T33A UPDATED 18637 with T33A UPDATED 18639 with T33A UPDATED 18634 with T33A UPDATED 18640 with T33A UPDATED 18641 with T33A UPDATED 18642 with L117R UPDATED 18643 with L117R UPDATED 18644 with L117R UPDATED 18638 with L117R UPDATED 18598 with L117R UPDATED 18599 with L117R UPDATED 18600 with L117R UPDATED 18620 with L117R UPDATED 18621 with L117R UPDATED 18622 with L117R UPDATED 18623 with L117R UPDATED 18624 with L117R UPDATED 18625 with L117R UPDATED 18626 with L117R UPDATED 14585 with T33A UPDATED 14615 with L117R UPDATED 14487 with T33A UPDATED 14517 with T33A UPDATED 14545 with N70D DELETED 41933 " 6012 UPDATE Mycobacterium tuberculosis Rv2535c with mutation conferring resistance to bedaquiline bedaquiline resistant Rv2535c; antibiotic without defined classification; diarylquinoline antibiotic; antibiotic target alteration; model_param; ARO_category "UPDATED 18594 with L44P UPDATED 18595 with L44P UPDATED 18596 with L44P UPDATED 18592 with L44P UPDATED 18591 with L44P UPDATED 18597 with L44P UPDATED 18594 with H100fs UPDATED 18595 with L317fs UPDATED 18596 with T341fs UPDATED 18592 with D51fs UPDATED 18591 with D232fs UPDATED 18597 with V273fs UPDATED category_aro_accession with 3000003 UPDATED category_aro_cvterm_id with 36012 UPDATED category_aro_name with antibiotic without defined classification UPDATED category_aro_description with These compounds are antibiotics of unique structure or origin, without a defined classification. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Loss-of-function mutations in Rv2535c (pepQ) in Mycobacterium and Mycobacteroides which are associated with resistance to bedaquiline. DELETED 40939 " 6013 UPDATE AMZ-1 AMZ beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35927 " 6015 UPDATE Salmonella gallinarum folP with mutation conferring resistance to sulfonamides sulfonamide resistant dihydropteroate synthase folP; sulfonamide antibiotic; antibiotic target alteration; ARO_category "DELETED 36468 " 6016 UPDATE Salmonella isangi gyrA conferring resistance to fluoroquinolones fluoroquinolone resistant gyrA; fluoroquinolone antibiotic; nybomycin-like antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3007157 UPDATED category_aro_cvterm_id with 45739 UPDATED category_aro_name with nybomycin-like antibiotic UPDATED category_aro_description with A group of antibiotics including nybomycin and its derivatives. UPDATED category_aro_class_name with Drug Class DELETED 35954 " 6017 UPDATE Salmonella isangi gyrB conferring resistance to fluoroquinolones fluoroquinolone resistant gyrB; fluoroquinolone antibiotic; antibiotic target alteration; ARO_category "DELETED 35954 " 6019 UPDATE Treponema pallidum 23S rRNA with mutation conferring resistance to erythromycin 23S rRNA with mutation conferring resistance to macrolide antibiotics; macrolide antibiotic; antibiotic target alteration; ARO_category "DELETED 35925 " 6020 UPDATE aac(6')-Ib-cr10 AAC(6'); AAC(6')-Ib-cr; fluoroquinolone antibiotic; aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35932 " 6021 UPDATE aac(6')-Ib-cr11 AAC(6'); AAC(6')-Ib-cr; fluoroquinolone antibiotic; aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35932 " 6022 UPDATE Vibrio vulnificus rpoB mutants conferring resistance to rifampin rifamycin-resistant beta-subunit of RNA polymerase (rpoB); rifamycin antibiotic; antibiotic target alteration; antibiotic target replacement; ARO_category "DELETED 36308 " 6023 UPDATE OXA-410 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 355 UPDATE TEM-1 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35975 " 6024 UPDATE Mycobacterium tuberculosis iniA mutations conferring resistance to isoniazid isoniazid resistant iniA; isoniazid-like antibiotic; antibiotic target alteration; antibiotic efflux; ARO_category "DELETED 36659 " 2404 UPDATE Neisseria gonorrhoeae gyrA with mutations conferring resistance to fluoroquinolones fluoroquinolone resistant gyrA; fluoroquinolone antibiotic; nybomycin-like antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3007157 UPDATED category_aro_cvterm_id with 45739 UPDATED category_aro_name with nybomycin-like antibiotic UPDATED category_aro_description with A group of antibiotics including nybomycin and its derivatives. UPDATED category_aro_class_name with Drug Class DELETED 35954 " 6062 UPDATE tet(65) major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline antibiotic; antibiotic efflux; ARO_category "DELETED 35968 " 6070 UPDATE Mycobacterium tuberculosis Rv0678 with mutation conferring resistance to clofazimine clofazimine resistant Rv0678; antibiotic without defined classification; antibiotic target alteration; model_param; ARO_category "UPDATED param_type with frameshift mutation UPDATED param_description with A frameshift is a sequence change between the translation initiation (start) and termination (stop) codon where, compared to a reference sequence, translation shifts to another reading frame as caused by nucleotide insertions and deletions. In ARO, these are annotated at the protein level with the first changed most N-terminal wildtype amino acid position. Format is given as [wildtype AA][position]fs, e.g. S531fs where S531 is a frameshifted coordinate beginning with codon 531. Termination may also be denoted as: Ter[position]fs. UPDATED param_type_id with 40494 UPDATED 18749 with Y157fs UPDATED 18750 with Y92fs UPDATED 18714 with A110fs UPDATED 18715 with A144fs UPDATED 18716 with A62fs UPDATED 18717 with R109fs UPDATED 18719 with R156fs UPDATED 18720 with R30fs UPDATED 18722 with R72fs UPDATED 18723 with N70fs UPDATED 18724 with N98fs UPDATED 18725 with D116fs UPDATED 18726 with D141fs UPDATED 18728 with D47fs UPDATED 18729 with D8fs UPDATED 18731 with C46fs UPDATED 18732 with E49fs UPDATED 18733 with G11fs UPDATED 18718 with R132fs UPDATED 18727 with D165fs UPDATED 18752 with V7fs UPDATED 18743 with M10fs UPDATED 18744 with M111fs UPDATED 18745 with P129fs UPDATED 18746 with P48fs UPDATED 18748 with S68fs UPDATED 18734 with G41fs UPDATED 18735 with I16fs UPDATED 18736 with I67fs UPDATED 18737 with I80fs UPDATED 18738 with L125fs UPDATED 18739 with L142fs UPDATED 18740 with L32fs UPDATED 18741 with L44fs UPDATED 18742 with L56fs UPDATED 18749 with G121R UPDATED 18750 with G121R UPDATED 18714 with M146T UPDATED 18715 with M146T UPDATED 18716 with M146T UPDATED 18717 with M146T UPDATED 18719 with M146T UPDATED 18720 with M146T UPDATED 18722 with M146T UPDATED 18723 with M146T UPDATED 18724 with M146T UPDATED 18725 with M146T UPDATED 18726 with M146T UPDATED 18728 with M146T UPDATED 18729 with M146T UPDATED 18731 with M146T UPDATED 18732 with M146T UPDATED 18733 with M146T UPDATED 18718 with M146T UPDATED 18727 with M146T UPDATED 18752 with M146T UPDATED 18743 with M146T UPDATED 18744 with M146T UPDATED 18745 with M146T UPDATED 18746 with M146T UPDATED 18748 with M146T UPDATED 18734 with M146T UPDATED 18735 with M146T UPDATED 18736 with M146T UPDATED 18737 with M146T UPDATED 18738 with M146T UPDATED 18739 with M146T UPDATED 18740 with M146T UPDATED 18741 with M146T UPDATED 18742 with M146T UPDATED 14599 with L32S UPDATED category_aro_accession with 3000003 UPDATED category_aro_cvterm_id with 36012 UPDATED category_aro_name with antibiotic without defined classification UPDATED category_aro_description with These compounds are antibiotics of unique structure or origin, without a defined classification. UPDATED category_aro_class_name with Drug Class DELETED 40939 " 6071 UPDATE Mycobacterium tuberculosis atpE with mutation conferring resistance to bedaquiline antibiotic resistant ATP synthase; diarylquinoline antibiotic; antibiotic target alteration; ARO_category "DELETED 41933 " 6072 UPDATE KPC-134 KPC beta-lactamase; monobactam; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36727 " 6075 UPDATE DYB-1 DYB beta-lactamase; carbapenem; cephalosporin; antibiotic inactivation; ARO_category "DELETED 35977 " 7552 UPDATE CTX-M-243 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 7553 UPDATE CTX-M-245 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 7554 UPDATE CTX-M-246 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 7555 UPDATE CTX-M-247 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 7556 UPDATE CTX-M-248 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 7557 UPDATE CTX-M-249 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 7558 UPDATE CTX-M-251 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 7559 UPDATE CTX-M-252 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 7560 UPDATE CTX-M-253 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 7561 UPDATE CTX-M-254 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 7562 UPDATE CTX-M-255 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 7563 UPDATE CTX-M-256 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 7564 UPDATE CTX-M-257 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 7565 UPDATE CTX-M-258 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 7566 UPDATE CTX-M-259 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 7568 UPDATE CTX-M-261 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 7569 UPDATE CTX-M-262 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 7570 UPDATE CTX-M-263 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 7571 UPDATE CTX-M-264 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 7572 UPDATE CTX-M-265 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 7573 UPDATE CTX-M-266 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 7574 UPDATE CTX-M-267 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 7575 UPDATE CTX-M-268 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 7576 UPDATE CTX-M-269 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 7577 UPDATE CTX-M-270 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 7578 UPDATE CTX-M-271 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 7579 UPDATE CTX-M-272 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 7580 UPDATE CTX-M-273 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 7581 UPDATE CTX-M-274 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 7582 UPDATE CTX-M-275 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 7583 UPDATE CTX-M-276 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 7584 UPDATE CTX-M-277 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 7585 UPDATE CTX-M-278 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 7626 UPDATE IMI-10 IMI beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 0000032 UPDATED category_aro_cvterm_id with 35951 UPDATED category_aro_name with cephalosporin UPDATED category_aro_description with Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000008 UPDATED category_aro_cvterm_id with 36017 UPDATED category_aro_name with penicillin beta-lactam UPDATED category_aro_description with Penicilins (Penams) are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. Penicillin-like antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_class_name with Drug Class " 7627 UPDATE IMI-22 IMI beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 0000032 UPDATED category_aro_cvterm_id with 35951 UPDATED category_aro_name with cephalosporin UPDATED category_aro_description with Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000008 UPDATED category_aro_cvterm_id with 36017 UPDATED category_aro_name with penicillin beta-lactam UPDATED category_aro_description with Penicilins (Penams) are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. Penicillin-like antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_class_name with Drug Class " 7628 UPDATE IMI-23 IMI beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 0000032 UPDATED category_aro_cvterm_id with 35951 UPDATED category_aro_name with cephalosporin UPDATED category_aro_description with Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000008 UPDATED category_aro_cvterm_id with 36017 UPDATED category_aro_name with penicillin beta-lactam UPDATED category_aro_description with Penicilins (Penams) are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. Penicillin-like antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_class_name with Drug Class " 7629 UPDATE IMI-24 IMI beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 0000032 UPDATED category_aro_cvterm_id with 35951 UPDATED category_aro_name with cephalosporin UPDATED category_aro_description with Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000008 UPDATED category_aro_cvterm_id with 36017 UPDATED category_aro_name with penicillin beta-lactam UPDATED category_aro_description with Penicilins (Penams) are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. Penicillin-like antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_class_name with Drug Class " 7630 UPDATE IMI-25 IMI beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 0000032 UPDATED category_aro_cvterm_id with 35951 UPDATED category_aro_name with cephalosporin UPDATED category_aro_description with Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000008 UPDATED category_aro_cvterm_id with 36017 UPDATED category_aro_name with penicillin beta-lactam UPDATED category_aro_description with Penicilins (Penams) are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. Penicillin-like antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_class_name with Drug Class " 7631 UPDATE IMI-26 IMI beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 0000032 UPDATED category_aro_cvterm_id with 35951 UPDATED category_aro_name with cephalosporin UPDATED category_aro_description with Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000008 UPDATED category_aro_cvterm_id with 36017 UPDATED category_aro_name with penicillin beta-lactam UPDATED category_aro_description with Penicilins (Penams) are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. Penicillin-like antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_class_name with Drug Class " 7632 UPDATE IMI-27 IMI beta-lactamase; carbapenem; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 0000032 UPDATED category_aro_cvterm_id with 35951 UPDATED category_aro_name with cephalosporin UPDATED category_aro_description with Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3000008 UPDATED category_aro_cvterm_id with 36017 UPDATED category_aro_name with penicillin beta-lactam UPDATED category_aro_description with Penicilins (Penams) are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. Penicillin-like antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_class_name with Drug Class " 7648 UPDATE KLUG-1 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 7839 UPDATE OXA-1000 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7840 UPDATE OXA-1001 OXA-229-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7841 UPDATE OXA-1002 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7842 UPDATE OXA-1003 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7843 UPDATE OXA-1004 OXA-294-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7844 UPDATE OXA-1005 OXA-134-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7845 UPDATE OXA-1006 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 7846 UPDATE OXA-1007 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7847 UPDATE OXA-1008 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7848 UPDATE OXA-1009 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7849 UPDATE OXA-1010 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7851 UPDATE OXA-1012 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7852 UPDATE OXA-1013 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7853 UPDATE OXA-1014 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7854 UPDATE OXA-1015 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7850 UPDATE OXA-1011 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 7855 UPDATE OXA-1016 OXA-372-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7856 UPDATE OXA-1017 OXA-2-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7857 UPDATE OXA-1018 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7858 UPDATE OXA-1019 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7859 UPDATE OXA-1020 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7860 UPDATE OXA-1021 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7861 UPDATE OXA-1022 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7862 UPDATE OXA-1023 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7863 UPDATE OXA-1024 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7864 UPDATE OXA-1025 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7865 UPDATE OXA-1026 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7866 UPDATE OXA-1027 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7867 UPDATE OXA-1028 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7868 UPDATE OXA-1029 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7869 UPDATE OXA-1030 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7870 UPDATE OXA-1031 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7871 UPDATE OXA-1032 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7872 UPDATE OXA-1033 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7873 UPDATE OXA-1034 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7874 UPDATE OXA-1035 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7875 UPDATE OXA-1036 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 7876 UPDATE OXA-1037 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 7877 UPDATE OXA-1040 OXA-24-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7878 UPDATE OXA-1041 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 7879 UPDATE OXA-1042 OXA-1-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7880 UPDATE OXA-1043 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 7881 UPDATE OXA-1044 OXA-211-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7882 UPDATE OXA-1045 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7883 UPDATE OXA-1046 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7884 UPDATE OXA-1047 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7885 UPDATE OXA-1048 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7886 UPDATE OXA-1049 OXA-2-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7887 UPDATE OXA-1050 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7888 UPDATE OXA-1051 OXA-679-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7889 UPDATE OXA-1052 OXA-229-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7890 UPDATE OXA-1053 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7891 UPDATE OXA-1055 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7892 UPDATE OXA-1056 OXA-198-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7893 UPDATE OXA-1057 OXA-198-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7894 UPDATE OXA-1058 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7895 UPDATE OXA-1059 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7896 UPDATE OXA-1060 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7897 UPDATE OXA-1061 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7898 UPDATE OXA-1062 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7899 UPDATE OXA-1063 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7900 UPDATE OXA-1064 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7901 UPDATE OXA-1065 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7902 UPDATE OXA-1066 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7903 UPDATE OXA-1067 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7904 UPDATE OXA-1068 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7905 UPDATE OXA-1069 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7906 UPDATE OXA-1070 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7907 UPDATE OXA-1071 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7908 UPDATE OXA-1072 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7909 UPDATE OXA-1073 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7910 UPDATE OXA-1074 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7911 UPDATE OXA-1075 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7912 UPDATE OXA-1076 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7913 UPDATE OXA-1077 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7914 UPDATE OXA-1078 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7915 UPDATE OXA-1079 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7916 UPDATE OXA-1080 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7917 UPDATE OXA-1081 OXA-24-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7918 UPDATE OXA-1082 OXA-2-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7919 UPDATE OXA-1083 OXA-2-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7920 UPDATE OXA-1084 OXA-2-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7921 UPDATE OXA-1085 OXA-2-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7922 UPDATE OXA-1086 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7923 UPDATE OXA-1087 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7924 UPDATE OXA-1088 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7925 UPDATE OXA-1089 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 7926 UPDATE OXA-1090 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 7927 UPDATE OXA-1091 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 7928 UPDATE OXA-1092 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7929 UPDATE OXA-1093 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7930 UPDATE OXA-1094 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7931 UPDATE OXA-1095 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7932 UPDATE OXA-1096 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7933 UPDATE OXA-1097 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7934 UPDATE OXA-1098 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7935 UPDATE OXA-1099 OXA-63-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7936 UPDATE OXA-1100 OXA-63-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7937 UPDATE OXA-1101 OXA-63-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7938 UPDATE OXA-1102 OXA-63-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7939 UPDATE OXA-1103 OXA-63-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7940 UPDATE OXA-1104 OXA-63-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7941 UPDATE OXA-1105 OXA-63-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7942 UPDATE OXA-1106 OXA-63-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7943 UPDATE OXA-1107 OXA-63-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7944 UPDATE OXA-1108 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 7945 UPDATE OXA-1109 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7946 UPDATE OXA-1110 OXA-134-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7947 UPDATE OXA-1111 OXA-134-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7948 UPDATE OXA-1112 OXA-134-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7949 UPDATE OXA-1113 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7950 UPDATE OXA-1114 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7951 UPDATE OXA-1115 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7952 UPDATE OXA-1116 OXA-134-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7953 UPDATE OXA-1117 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7954 UPDATE OXA-1118 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7955 UPDATE OXA-1119 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7956 UPDATE OXA-1120 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7957 UPDATE OXA-1121 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7958 UPDATE OXA-1122 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7959 UPDATE OXA-1123 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7960 UPDATE OXA-1124 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7961 UPDATE OXA-1125 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7962 UPDATE OXA-1126 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7963 UPDATE OXA-1127 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7964 UPDATE OXA-1128 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7965 UPDATE OXA-1129 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7966 UPDATE OXA-1130 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7967 UPDATE OXA-1131 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7968 UPDATE OXA-1132 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7969 UPDATE OXA-1133 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7970 UPDATE OXA-1134 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7971 UPDATE OXA-1135 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7972 UPDATE OXA-1136 OXA-2-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7973 UPDATE OXA-1137 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7974 UPDATE OXA-1138 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7975 UPDATE OXA-1139 OXA-143-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7976 UPDATE OXA-1140 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7977 UPDATE OXA-1141 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7978 UPDATE OXA-1142 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 7979 UPDATE OXA-1143 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 7980 UPDATE OXA-1144 OXA-229-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7981 UPDATE OXA-1145 OXA-286-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7982 UPDATE OXA-1146 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7983 UPDATE OXA-1147 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7984 UPDATE OXA-1148 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7985 UPDATE OXA-1149 OXA-62-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7986 UPDATE OXA-1150 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7987 UPDATE OXA-1151 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7988 UPDATE OXA-1152 OXA-62-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7989 UPDATE OXA-1153 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 7990 UPDATE OXA-1154 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 7991 UPDATE OXA-1155 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 7992 UPDATE OXA-1156 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 7993 UPDATE OXA-1157 OXA-12-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7994 UPDATE OXA-1158 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 7995 UPDATE OXA-1159 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 7996 UPDATE OXA-1160 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 7997 UPDATE OXA-1161 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 7998 UPDATE OXA-1162 OXA-12-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 7999 UPDATE OXA-1163 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 8000 UPDATE OXA-1164 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8001 UPDATE OXA-1165 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8002 UPDATE OXA-1166 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8003 UPDATE OXA-1167 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8004 UPDATE OXA-1168 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8005 UPDATE OXA-1169 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8006 UPDATE OXA-1170 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8007 UPDATE OXA-1171 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8008 UPDATE OXA-1172 OXA-2-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8009 UPDATE OXA-1173 OXA-2-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8010 UPDATE OXA-1174 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8011 UPDATE OXA-1175 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8012 UPDATE OXA-1176 OXA-60-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8013 UPDATE OXA-1177 OXA-22-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8014 UPDATE OXA-1178 OXA-58-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8015 UPDATE OXA-1181 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8016 UPDATE OXA-1182 OXA-143-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8017 UPDATE OXA-1183 OXA-2-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8018 UPDATE OXA-1184 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8019 UPDATE OXA-1185 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8020 UPDATE OXA-1186 OXA-198-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8021 UPDATE OXA-1187 OXA-2-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8022 UPDATE OXA-1188 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8023 UPDATE OXA-1189 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8024 UPDATE OXA-1190 OXA-229-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8025 UPDATE OXA-1191 OXA-229-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8026 UPDATE OXA-1193 OXA-229-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8027 UPDATE OXA-1194 OXA-229-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8028 UPDATE OXA-1198 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8029 UPDATE OXA-1199 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8030 UPDATE OXA-1200 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8031 UPDATE OXA-1201 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8032 UPDATE OXA-1202 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8033 UPDATE OXA-1203 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8034 UPDATE OXA-1204 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8035 UPDATE OXA-1205 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8036 UPDATE OXA-1206 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 8037 UPDATE OXA-1207 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8038 UPDATE OXA-1208 OXA-211-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8039 UPDATE OXA-1211 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8040 UPDATE OXA-1212 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8041 UPDATE OXA-1213 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8042 UPDATE OXA-1214 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8043 UPDATE OXA-1215 OXA-286-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8044 UPDATE OXA-1216 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8045 UPDATE OXA-1217 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8046 UPDATE OXA-1218 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8047 UPDATE OXA-1219 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8048 UPDATE OXA-1220 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8049 UPDATE OXA-1221 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8050 UPDATE OXA-1222 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8051 UPDATE OXA-1223 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8052 UPDATE OXA-1224 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8053 UPDATE OXA-1225 OXA-24-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8054 UPDATE OXA-1226 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8055 UPDATE OXA-1227 OXA-62-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8056 UPDATE OXA-1228 OXA-62-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8057 UPDATE OXA-1229 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8058 UPDATE OXA-1230 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8059 UPDATE OXA-1231 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8060 UPDATE OXA-1232 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8061 UPDATE OXA-1233 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8062 UPDATE OXA-1234 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8063 UPDATE OXA-1235 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8064 UPDATE OXA-1236 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8065 UPDATE OXA-1237 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8066 UPDATE OXA-1238 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 8067 UPDATE OXA-1239 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 8068 UPDATE OXA-1240 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8069 UPDATE OXA-1241 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8070 UPDATE OXA-1242 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8071 UPDATE OXA-1243 OXA-2-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8072 UPDATE OXA-1244 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8073 UPDATE OXA-1245 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8074 UPDATE OXA-1246 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8075 UPDATE OXA-1247 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8076 UPDATE OXA-1248 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8077 UPDATE OXA-1249 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8078 UPDATE OXA-1250 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8079 UPDATE OXA-1251 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 8080 UPDATE OXA-1252 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8081 UPDATE OXA-1253 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8082 UPDATE OXA-1254 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8083 UPDATE OXA-1255 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8084 UPDATE OXA-1256 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8085 UPDATE OXA-1257 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8086 UPDATE OXA-1258 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 8087 UPDATE OXA-1259 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 8088 UPDATE OXA-1260 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 8089 UPDATE OXA-1261 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 8091 UPDATE OXA-1263 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36030 " 8092 UPDATE OXA-1264 OXA-62-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8093 UPDATE OXA-1265 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8094 UPDATE OXA-1266 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8095 UPDATE OXA-1267 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8096 UPDATE OXA-1268 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8097 UPDATE OXA-1269 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8098 UPDATE OXA-1270 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8099 UPDATE OXA-1271 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8100 UPDATE OXA-1272 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8101 UPDATE OXA-1273 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8102 UPDATE OXA-1274 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8103 UPDATE OXA-1275 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8104 UPDATE OXA-1276 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8105 UPDATE OXA-1277 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8106 UPDATE OXA-1278 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8107 UPDATE OXA-1279 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8108 UPDATE OXA-1280 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8109 UPDATE OXA-1281 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8110 UPDATE OXA-1282 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8111 UPDATE OXA-1283 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8112 UPDATE OXA-1284 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8113 UPDATE OXA-1285 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8114 UPDATE OXA-1286 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8115 UPDATE OXA-1287 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8116 UPDATE OXA-1288 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8117 UPDATE OXA-1289 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8118 UPDATE OXA-1290 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8119 UPDATE OXA-1291 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8120 UPDATE OXA-1292 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8121 UPDATE OXA-1293 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8122 UPDATE OXA-1294 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8123 UPDATE OXA-1295 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8124 UPDATE OXA-1296 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8125 UPDATE OXA-1297 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8126 UPDATE OXA-1298 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8127 UPDATE OXA-1299 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8128 UPDATE OXA-1300 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8129 UPDATE OXA-1301 OXA-50-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8130 UPDATE OXA-1302 OXA-10-like beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8131 UPDATE OXA-1303 OXA-24-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8132 UPDATE OXA-1304 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8133 UPDATE OXA-1305 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8134 UPDATE OXA-1306 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8135 UPDATE OXA-1307 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8136 UPDATE OXA-1308 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8137 UPDATE OXA-1309 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8138 UPDATE OXA-725 OXA-12-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8139 UPDATE OXA-790 OXA-114-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8140 UPDATE OXA-791 OXA-114-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8141 UPDATE OXA-933 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8142 UPDATE OXA-934 OXA-48-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8143 UPDATE OXA-936 OXA-214-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8144 UPDATE OXA-944 OXA-274-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8145 UPDATE OXA-950 OXA-12-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8146 UPDATE OXA-951 OXA-12-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8147 UPDATE OXA-952 OXA-229-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8148 UPDATE OXA-953 OXA-229-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8149 UPDATE OXA-954 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8150 UPDATE OXA-955 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8151 UPDATE OXA-956 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 8152 UPDATE OXA-957 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 8153 UPDATE OXA-958 OXA-12-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8154 UPDATE OXA-959 OXA-12-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8155 UPDATE OXA-960 OXA-55-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8156 UPDATE OXA-961 OXA-55-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8157 UPDATE OXA-962 OXA-55-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8158 UPDATE OXA-963 OXA-55-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8159 UPDATE OXA-964 OXA-55-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8160 UPDATE OXA-965 OXA-55-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8161 UPDATE OXA-966 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8162 UPDATE OXA-967 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8163 UPDATE OXA-968 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8164 UPDATE OXA-969 OXA-23-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8165 UPDATE OXA-970 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8166 UPDATE OXA-971 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8167 UPDATE OXA-972 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8168 UPDATE OXA-973 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8169 UPDATE OXA-974 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8170 UPDATE OXA-975 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8171 UPDATE OXA-976 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8172 UPDATE OXA-977 OXA-51-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8173 UPDATE OXA-978 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8174 UPDATE OXA-979 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8175 UPDATE OXA-980 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8176 UPDATE OXA-981 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 8177 UPDATE OXA-982 OXA-294-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8178 UPDATE OXA-983 OXA-229-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8179 UPDATE OXA-984 OXA-294-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8180 UPDATE OXA-985 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8181 UPDATE OXA-986 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8182 UPDATE OXA-987 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8183 UPDATE OXA-988 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8184 UPDATE OXA-989 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8185 UPDATE OXA-990 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8186 UPDATE OXA-991 OXA-134-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8187 UPDATE OXA-992 OXA-213-like beta-lactamase; carbapenem; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8188 UPDATE OXA-993 OXA-294-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8189 UPDATE OXA-994 OXA-294-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8190 UPDATE OXA-995 OXA-294-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8191 UPDATE OXA-996 OXA-294-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8192 UPDATE OXA-997 OXA-294-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8193 UPDATE OXA-998 OXA-294-like beta-lactamase; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36026 " 8194 UPDATE OXA-999 OXA beta-lactamase without subfamily; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3009641 UPDATED category_aro_cvterm_id with 48502 UPDATED category_aro_name with OXA beta-lactamase without subfamily UPDATED category_aro_description with Oxacillin-hydrolyzing class D OXA beta-lactamases without assigned sub-family. UPDATED category_aro_class_name with AMR Gene Family DELETED 36026 " 8462 UPDATE SED-2 SED beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 0000032 UPDATED category_aro_cvterm_id with 35951 UPDATED category_aro_name with cephalosporin UPDATED category_aro_description with Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_class_name with Drug Class " 8484 UPDATE TEM-239 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36981 " 8485 UPDATE TEM-248 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36981 " 8486 UPDATE TEM-249 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36981 " 8487 UPDATE TEM-250 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36981 " 8488 UPDATE TEM-251 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36981 " 8489 UPDATE TEM-252 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36981 " 8490 UPDATE TEM-253 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36981 " 8491 UPDATE TEM-254 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36981 " 8492 UPDATE TEM-255 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36981 " 8493 UPDATE TEM-256 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36981 " 8494 UPDATE TEM-257 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36981 " 8495 UPDATE TEM-258 TEM beta-lactamase; monobactam; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 36981 " 3779 UPDATE YRC-1 YRC beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35927 " 1294 UPDATE SED-1 SED beta-lactamase; cephalosporin; penicillin beta-lactam; antibiotic inactivation; ARO_category "DELETED 35980 " 1237 UPDATE Mycobacterium tuberculosis rpoB with mutations conferring resistance to rifampicin rifamycin-resistant beta-subunit of RNA polymerase (rpoB); rifamycin antibiotic; antibiotic target alteration; antibiotic target replacement; model_param; ARO_category "UPDATED param_type with duplication of peptide sequence UPDATED param_description with A duplication is a sequence change between the translation initiation (start) and termination (stop) codon where, compared to a reference sequence, a copy of one or more amino acids is inserted directly C-terminal of the original copy of that sequence. UPDATED param_type_id with 48031 UPDATED 19306 with T444dup UPDATED 19297 with F433dup UPDATED param_type with insertion mutation from peptide sequence UPDATED param_description with A peptide sequence change between the translation initiation (start) and termination (stop) codon where, compared to the reference sequence, one or more amino acids are inserted. These represent in-frame insertions which do not result in frameshift variants and where the insertion is not a duplication of a sequence immediately N-terminal (5'), and are denoted with wildtype flanking residues. Format is given by [wildtype AA position]_[wildtype AA position]ins[AA sequence], e.g. K464_D465insE or P46_A47insYS. UPDATED param_type_id with 41344 UPDATED 19292 with M434_D435insV UPDATED 19299 with S431_Q432insR UPDATED 19300 with S431_Q432insH UPDATED 19286 with L430_S431insR UPDATED 14202 with T444Var UPDATED 14203 with H445Var UPDATED 14204 with K446Var UPDATED 14205 with R447Var UPDATED 14206 with R448Var UPDATED 14207 with L449Var UPDATED 14364 with D435Y UPDATED 16028 with S428Var UPDATED 16037 with N437Var UPDATED 14423 with S450Q UPDATED 14433 with L452P UPDATED 4035 with S431R UPDATED 4083 with N437I UPDATED 4075 with H445P UPDATED 4042 with T427P UPDATED 14199 with S441Var DELETED 13306 UPDATED 19265 with S431I UPDATED 19266 with S431I UPDATED 19267 with S431I UPDATED 19269 with S431I UPDATED 19272 with S431I UPDATED 19268 with S431I UPDATED 19271 with S431I UPDATED 19273 with S431I UPDATED 19274 with S431I UPDATED 19275 with S431I UPDATED 19276 with S431I UPDATED 19277 with S431I UPDATED 19279 with S431I UPDATED 19283 with S431I UPDATED 19301 with S431I UPDATED 19302 with S431I UPDATED 19303 with S431I UPDATED 19305 with S431I UPDATED 19306 with S431I UPDATED 19284 with S431I UPDATED 19304 with S431I UPDATED 19291 with S431I UPDATED 19292 with S431I UPDATED 19294 with S431I UPDATED 19295 with S431I UPDATED 19296 with S431I UPDATED 19297 with S431I UPDATED 19299 with S431I UPDATED 19300 with S431I UPDATED 19285 with S431I UPDATED 19286 with S431I UPDATED 19287 with S431I UPDATED 19290 with S431I UPDATED 4074 with A451Var UPDATED 4061 with T427H UPDATED 4105 with G426D UPDATED 4058 with G426D UPDATED 4059 with G426D UPDATED 4108 with T427P UPDATED 4067 with H445N UPDATED 4065 with H445N UPDATED 4066 with H445N UPDATED 4060 with H445N UPDATED 4057 with S450C UPDATED 4068 with Q436H UPDATED 4062 with G426S UPDATED 19265 with N437_N438del UPDATED 19266 with N438del UPDATED 19267 with D435_Q436del UPDATED 19269 with D435del UPDATED 19272 with Q432_M434del UPDATED 19268 with D435_Q436del UPDATED 19271 with Q432_D435del UPDATED 19273 with Q432_M434del UPDATED 19274 with Q432_F433del UPDATED 19275 with Q432del UPDATED 19276 with Q436_N437del UPDATED 19277 with Q436del UPDATED 19279 with G426_T427del UPDATED 19283 with H445_K446del UPDATED 19301 with S431_M434del UPDATED 19302 with S450_L452del UPDATED 19303 with T427_Q429del UPDATED 19305 with T427_S428del UPDATED 19284 with H445_K446del UPDATED 19304 with T427_Q429del UPDATED 19291 with M434_D435del UPDATED 19294 with F425_G426del UPDATED 19295 with F433_D435del UPDATED 19296 with F433_Q436del UPDATED 19285 with L430_Q432del UPDATED 19287 with L443_K446del UPDATED 19290 with M434_N437del DELETED 36308 " 6069 UPDATE Mycobacterium tuberculosis fgd1 with mutation conferring resistance to delamanid delamanid-resistant fgd1; nitroimidazole antibiotic; antibiotic target alteration; model_param; ARO_category "UPDATED param_type with frameshift mutation UPDATED param_description with A frameshift is a sequence change between the translation initiation (start) and termination (stop) codon where, compared to a reference sequence, translation shifts to another reading frame as caused by nucleotide insertions and deletions. In ARO, these are annotated at the protein level with the first changed most N-terminal wildtype amino acid position. Format is given as [wildtype AA][position]fs, e.g. S531fs where S531 is a frameshifted coordinate beginning with codon 531. Termination may also be denoted as: Ter[position]fs. UPDATED param_type_id with 40494 UPDATED 18773 with N112fs UPDATED 18773 with V1Var DELETED 41931 " 5956 UPDATE Mycobacterium avium gyrA with mutation conferring resistance to fluoroquinolone fluoroquinolone resistant gyrA; fluoroquinolone antibiotic; nybomycin-like antibiotic; antibiotic target alteration; ARO_category "UPDATED category_aro_accession with 3007157 UPDATED category_aro_cvterm_id with 45739 UPDATED category_aro_name with nybomycin-like antibiotic UPDATED category_aro_description with A group of antibiotics including nybomycin and its derivatives. UPDATED category_aro_class_name with Drug Class DELETED 35954 " 7567 UPDATE CTX-M-260 CTX-M beta-lactamase; cephalosporin; azole antibiotic; imidazole antibiotic; antibiotic inactivation; ARO_category "UPDATED category_aro_accession with 3007495 UPDATED category_aro_cvterm_id with 46264 UPDATED category_aro_name with azole antibiotic UPDATED category_aro_description with Azoles are a group of antibiotics, particularly antifungals, that target the cytochrome P450 enzyme sterol 14alpha-demethylase, which converts lanosterol to ergosterol. They are typically fungistatic in yeasts and fungicidal in molds. The two main groups of azoles are imidazoles and triazoles. UPDATED category_aro_class_name with Drug Class UPDATED category_aro_accession with 3007500 UPDATED category_aro_cvterm_id with 46269 UPDATED category_aro_name with imidazole antibiotic UPDATED category_aro_description with Imidazoles are a group of antibiotics, particularly antifungals, derived from azoles. Imidazoles include imidazole derivatives clotrimazole, ketoconazole, miconazole, econazole and oxiconazole. UPDATED category_aro_class_name with Drug Class " 5925 UPDATE Escherichia coli PBP3 mutants conferring resistance to beta-lactam antibiotics penicillin-binding protein with mutation conferring resistance to beta-lactam antibiotics; monobactam; cephalosporin; penicillin beta-lactam; antibiotic target alteration; ARO_category "UPDATED category_aro_name with penicillin-binding protein with mutation conferring resistance to beta-lactam antibiotics DELETED 35977 " 209 UPDATE AAC(3)-Ib/AAC(6')-Ib3 bifunctional protein aminoglycoside bifunctional resistance protein; aminoglycoside antibiotic; antibiotic inactivation; ARO_category "DELETED 35922 " 431 UPDATE Escherichia coli AcrAB-TolC with MarR mutations conferring resistance to ciprofloxacin and tetracycline resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; fluoroquinolone antibiotic; cephalosporin; glycylcycline; penicillin beta-lactam; tetracycline antibiotic; rifamycin antibiotic; phenicol antibiotic; disinfecting agents and antiseptics; antibiotic target alteration; antibiotic efflux; model_name; model_param; ARO_name; ARO_description; ARO_category "UPDATED model_name with Escherichia coli MarR with mutation associated with multidrug resistance UPDATED 3898 with A70T UPDATED ARO_name with Escherichia coli MarR with mutation associated with multidrug resistance UPDATED ARO_description with MarR is a transcriptional regulator and repressor for the expression of marA, itself an activator of the multidrug efflux pump AcrAB. Certain mutations in the marR gene are associated with increased resistance to drugs including tetracycline and ciprofloxacin through increased AcrAB activity. UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35949 " 2306 UPDATE Escherichia coli AcrAB-TolC with AcrR mutation conferring resistance to ciprofloxacin, tetracycline, and ceftazidime resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux regulatory protein; fluoroquinolone antibiotic; cephalosporin; glycylcycline; penicillin beta-lactam; tetracycline antibiotic; rifamycin antibiotic; phenicol antibiotic; disinfecting agents and antiseptics; antibiotic target alteration; antibiotic efflux; model_name; ARO_name; ARO_description; ARO_category "UPDATED model_name with Escherichia coli AcrR with mutation associated with multidrug resistance UPDATED ARO_name with Escherichia coli AcrR with mutation associated with multidrug resistance UPDATED ARO_description with AcrR is a regulator and repressor of the AcrAB-TolC multidrug efflux complex in Escherichia coli. Certain mutations in AcrR are associated with increased tetracycline and fluoroquinolone resistance, among others, by deregulating the efflux activity of AcrAB-TolC. UPDATED category_aro_accession with 3009640 UPDATED category_aro_cvterm_id with 48501 UPDATED category_aro_name with antibiotic efflux regulatory protein UPDATED category_aro_description with Gene products that regulate efflux of antibiotics from cells. UPDATED category_aro_class_name with AMR Gene Family DELETED 35949 " 2695 DELETE MexCD-OprJ with type B NfxB mutation resistance-nodulation-cell division (RND) antibiotic efflux pump; erythromycin; gentamicin C; tetracycline; novobiocin; trimethoprim; chloramphenicol; ofloxacin; gentamicin; macrolide antibiotic; fluoroquinolone antibiotic; aminoglycoside antibiotic; cephalosporin; penicillin beta-lactam; tetracycline antibiotic; aminocoumarin antibiotic; diaminopyrimidine antibiotic; phenicol antibiotic; efflux pump complex or subunit conferring antibiotic resistance; antibiotic efflux; N/A N/A 3783 DELETE YajC resistance-nodulation-cell division (RND) antibiotic efflux pump; vancomycin; tigecycline; tetracycline; linezolid; rifampin; chloramphenicol; ampicillin; cefalotin; triclosan; fluoroquinolone antibiotic; cephalosporin; glycylcycline; penicillin beta-lactam; tetracycline antibiotic; oxazolidinone antibiotic; glycopeptide antibiotic; rifamycin antibiotic; phenicol antibiotic; disinfecting agents and antiseptics; efflux pump complex or subunit conferring antibiotic resistance; antibiotic efflux; N/A N/A 2215 DELETE Pseudomonas aeruginosa gyrA and parC conferring resistance to fluoroquinolones fluoroquinolone resistant parC; ciprofloxacin; ofloxacin; pefloxacin; fluoroquinolone antibiotic; antibiotic target alteration; N/A N/A 2694 DELETE MexCD-OprJ with type A NfxB mutation resistance-nodulation-cell division (RND) antibiotic efflux pump; erythromycin; tetracycline; novobiocin; trimethoprim; chloramphenicol; ofloxacin; macrolide antibiotic; fluoroquinolone antibiotic; cephalosporin; penicillin beta-lactam; tetracycline antibiotic; aminocoumarin antibiotic; diaminopyrimidine antibiotic; phenicol antibiotic; efflux pump complex or subunit conferring antibiotic resistance; antibiotic efflux; N/A N/A