RbpA

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3000245
CARD Short NameRbpA
DefinitionRNA-polymerase binding protein which confers resistance to rifampin.
AMR Gene FamilyRbpA bacterial RNA polymerase-binding protein
Drug Classrifamycin antibiotic
Resistance Mechanismantibiotic target protection
Classification8 ontology terms | Show
Parent Term(s)5 ontology terms | Show
+ confers_resistance_to_antibiotic rifampin [Antibiotic]
+ confers_resistance_to_antibiotic rifaximin [Antibiotic]
+ confers_resistance_to_antibiotic rifabutin [Antibiotic]
+ confers_resistance_to_antibiotic rifapentine [Antibiotic]
+ RbpA bacterial RNA polymerase-binding protein [AMR Gene Family]
Resistomes with Sequence VariantsMycobacterium aviumg+wgs, Mycobacterium colombienseg+wgs, Mycobacterium intracellulareg+wgs, Mycobacterium kansasiig+wgs, Mycobacterium lepraeg+wgs, Mycobacterium lepromatosisg+wgs, Mycobacterium marinumg+wgs, Mycobacterium tuberculosisg+wgs, Mycobacterium ulceransg+wgs, Mycolicibacterium fortuitumg+wgs, Mycolicibacterium septicumg+wgs, Rhodococcus pyridinivoransg+wgs+gi, Rhodococcus rhodochrousg+wgs+gi, Streptococcus lutetiensiswgs
Publications

Newell KV, et al. 2006. Mol Microbiol 60(3): 687-696. The RNA polymerase-binding protein RbpA confers basal levels of rifampicin resistance on Streptomyces coelicolor. (PMID 16629670)

Dey A, et al. 2011. Microbiology 157(PT 7): 2056-2071. Molecular insights into the mechanism of phenotypic tolerance to rifampicin conferred on mycobacterial RNA polymerase by MsRbpA. (PMID 21415119)

Resistomes

Prevalence of RbpA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Mycobacterium avium100%0%98.56%0%0%
Mycobacterium colombiense100%0%100%0%0%
Mycobacterium intracellulare100%0%100%0%0%
Mycobacterium kansasii100%0%100%0%0%
Mycobacterium leprae100%0%100%0%0%
Mycobacterium lepromatosis100%0%100%0%0%
Mycobacterium marinum100%0%98.11%0%0%
Mycobacterium tuberculosis100%0%99.09%0%0%
Mycobacterium ulcerans100%0%100%0%0%
Mycolicibacterium fortuitum100%0%100%0%0%
Mycolicibacterium septicum100%0%100%0%0%
Rhodococcus pyridinivorans100%0%100%100%0%
Rhodococcus rhodochrous100%0%100%100%0%
Streptococcus lutetiensis0%0%2.04%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 200


>gb|ADV91011.1|+|RbpA [Mycolicibacterium smegmatis MC2 155]
MADRVLRGSRLGAVSYETDRNHDLAPRQVARYRTDNGEEFDVPFADDAEIPGTWLCRNGLEGTLIEGDVPEPKKVKPPRTHWDMLLERRS
VEELEELLKERLDLIKAKRRGTGS


>gb|HQ203032.1|+|1-345|RbpA [Mycolicibacterium smegmatis MC2 155]
ATGGCTGATCGTGTCCTGCGGGGCAGTCGCCTCGGAGCCGTGAGCTACGAGACCGACCGCAACCATGACCTGGCGCCGCGTCAGGTCGCC
CGCTACCGCACGGATAACGGCGAGGAGTTCGACGTACCTTTCGCCGACGACGCCGAGATCCCCGGTACGTGGCTCTGCCGCAACGGTCTG
GAGGGCACCCTCATCGAGGGTGACGTGCCGGAGCCCAAGAAGGTCAAGCCGCCGCGTACGCACTGGGACATGCTGTTGGAGCGCCGGTCC
GTCGAGGAGCTCGAAGAGCTGCTCAAGGAGCGTCTCGACCTGATCAAGGCCAAGCGGCGCGGAACCGGAAGCTGA

Curator Acknowledgements
Curator Description Most Recent Edit