mecA

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3000617
Synonym(s)PBP2A
CARD Short NamemecA
DefinitionmecA encodes an alternative PBP2a protein involved in bacterial cell wall formation. These proteins are acquired by lateral gene transfer and commonly associated with methicillin-resistant Staphylococcus aureus (MRSA). These proteins have lower affinity for penicillin-like antibiotics and therefore are able to perform peptidoglycan synthesis in the presence of beta-lactams.
AMR Gene FamilyPBP2-like beta-lactam resistant peptidoglycan transpeptidase
Drug Classpenicillin beta-lactam, cephalosporin, carbapenem, monobactam
Resistance Mechanismantibiotic target replacement
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONStaphylococcus aureus (862), Staphylococcus epidermidis (122), Staphylococcus (105), Staphylococcus haemolyticus (45), Staphylococcus pseudintermedius (30), Staphylococcus hominis (17), Staphylococcus sciuri (16), Staphylococcus intermedius (14), Escherichia coli (11), Streptococcus pneumoniae (9)
GAZJapan (18), Europe (12), Tokyo (10), Brazil (9), Germany (7), Kingdom of Denmark (6), Iran (5), China (5), Nigeria (5), Chile (4)
FOODONcow milk (liquid) (24), Bos taurus (17), water food product (17), swine (15), meat (skinless) (13), dairy cow (10), chicken (8), cheese food product (7), pork meat food product (7), food (ready-to-serve) (6)
ENVOhospital (57), farm (20), large river delta biome (4), abattoir (3), wastewater treatment plant (2), landlocked sea (2), park (2)
UBERONblood (69), animal hemisphere (34), manus (15), zone of skin (12), membrane organ (9), feces (7), tissue (5), pair of nares (4), sputum (4), blood plasma (3)
Classification71 ontology terms | Show
+ process or component of antibiotic biology or chemistry
+ antibiotic molecule
+ beta-lactam antibiotic
+ penicillin beta-lactam [Drug Class]
+ cephalosporin [Drug Class]
+ beta-lactamase resistant penicillin
+ beta-lactamase sensitive penicillin
+ penicillin with extended spectrum
+ other cephalosporins and penems
+ fourth-generation cephalosporin [Drug Subclass]
+ third-generation cephalosporin [Drug Subclass]
+ second-generation cephalosporin [Drug Subclass]
+ first-generation cephalosporin [Drug Subclass]
+ antibiotic target
+ carbapenem [Drug Class]
+ monobactam [Drug Class]
+ moxalactam [Antibiotic]
+ loracarbef [Antibiotic]
+ cefradine [Antibiotic]
+ cephapirin [Antibiotic]
+ ceftizoxime [Antibiotic]
+ ceftiofur [Antibiotic]
+ cefprozil [Antibiotic]
+ cefonicid [Antibiotic]
+ cefmetazole [Antibiotic]
+ mecillinam [Antibiotic]
+ cell wall synthesis enzyme targeted by antibiotic
+ cefalotin [Antibiotic]
+ ceftaroline [Antibiotic]
+ cefdinir [Antibiotic]
+ cefditoren [Antibiotic]
+ ceftibuten [Antibiotic]
+ cefpodoxime [Antibiotic]
+ cefixime [Antibiotic]
+ cefotaxime [Antibiotic]
+ cefaclor [Antibiotic]
+ cefotiam [Antibiotic]
+ cefadroxil [Antibiotic]
+ cefalexin [Antibiotic]
+ doripenem [Antibiotic]
+ mezlocillin [Antibiotic]
+ azlocillin [Antibiotic]
+ ampicillin [Antibiotic]
+ flucloxacillin [Antibiotic]
+ dicloxacillin [Antibiotic]
+ propicillin [Antibiotic]
+ phenoxymethylpenicillin [Antibiotic]
+ benzylpenicillin [Antibiotic]
+ aztreonam [Antibiotic]
+ imipenem [Antibiotic]
+ mechanism of antibiotic resistance
+ piperacillin [Antibiotic]
+ meropenem [Antibiotic]
+ ertapenem [Antibiotic]
+ amoxicillin [Antibiotic]
+ cefuroxime [Antibiotic]
+ ceftriaxone [Antibiotic]
+ ceftobiprole [Antibiotic]
+ ceftazidime [Antibiotic]
+ cefepime [Antibiotic]
+ cefazolin [Antibiotic]
+ oxacillin [Antibiotic]
+ carbenicillin [Antibiotic]
+ methicillin [Antibiotic]
+ cloxacillin [Antibiotic]
+ cefoxitin [Antibiotic]
+ beta-lactam sensitive penicillin-binding protein
+ determinant of antibiotic resistance
+ antibiotic target replacement [Resistance Mechanism]
+ beta-lactam resistant penicillin-binding proteins
+ antibiotic target replacement protein
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic methicillin [Antibiotic]
+ confers_resistance_to_antibiotic ceftaroline [Antibiotic]
+ PBP2-like beta-lactam resistant peptidoglycan transpeptidase [AMR Gene Family]
Sub-Term(s)
2 ontology terms | Show
+ mecR1 regulates
+ mecA-type mecI regulates
Resistomes with Perfect MatchesStaphylococcus aureusg+wgs
Resistomes with Sequence VariantsStaphylococcus arlettaeg+wgs, Staphylococcus aureusg+p+wgs+gi, Staphylococcus capitisg+wgs, Staphylococcus epidermidisg+p+wgs, Staphylococcus haemolyticusg+wgs, Staphylococcus hominisg+wgs, Staphylococcus lugdunensisg+wgs, Staphylococcus pasteuriwgs, Staphylococcus pseudintermediusg+wgs+gi, Staphylococcus saprophyticusg+wgs, Staphylococcus schleiferig+gi, Staphylococcus simulanswgs, Staphylococcus warneriwgs
Publications

Deurenberg RH and Stobberingh EE. 2008. Infect Genet Evol 8(6): 747-763. The evolution of Staphylococcus aureus. (PMID 18718557)

Utsui Y and Yokota T. 1985. Antimicrob Agents Chemother 28(3): 397-403. Role of an altered penicillin-binding protein in methicillin- and cephem-resistant Staphylococcus aureus. (PMID 3878127)

Cuny C, et al. 2011. PLoS One 6(9): E24360. Rare occurrence of methicillin-resistant Staphylococcus aureus CC130 with a novel mecA homologue in humans in Germany. (PMID 21931689)

Shore AC, et al. 2011. Antimicrob Agents Chemother 55(8): 3765-3773. Detection of staphylococcal cassette chromosome mec type XI carrying highly divergent mecA, mecI, mecR1, blaZ, and ccr genes in human clinical isolates of clonal complex 130 methicillin-resistant Staphylococcus aureus. (PMID 21636525)

Fuda C, et al. 2004. J Biol Chem 279(39): 40802-40806. The basis for resistance to beta-lactam antibiotics by penicillin-binding protein 2a of methicillin-resistant Staphylococcus aureus. (PMID 15226303)

Lim D and Strynadka NC. 2002. Nat Struct Biol 9(11): 870-876. Structural basis for the beta lactam resistance of PBP2a from methicillin-resistant Staphylococcus aureus. (PMID 12389036)

Ubukata K, et al. 1989. J Bacteriol 171(5): 2882-2885. Expression and inducibility in Staphylococcus aureus of the mecA gene, which encodes a methicillin-resistant S. aureus-specific penicillin-binding protein. (PMID 2708325)

Hartman BJ and Tomasz A. 1984. J Bacteriol 158(2): 513-516. Low-affinity penicillin-binding protein associated with beta-lactam resistance in Staphylococcus aureus. (PMID 6563036)

Kpeli G, et al. 2016. New Microbes New Infect 13:92-101 Possible healthcare-associated transmission as a cause of secondary infection and population structure of Staphylococcus aureus isolates from two wound treatment centres in Ghana. (PMID 27547406)

Resistomes

Prevalence of mecA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Staphylococcus arlettae16.67%0%5%0%0%
Staphylococcus aureus45.03%0.22%69.64%9.74%0%
Staphylococcus capitis30%0%38.61%0%0%
Staphylococcus epidermidis56.13%0.29%50.13%0%0%
Staphylococcus haemolyticus58.62%0%57.36%0%0%
Staphylococcus hominis25%0%27.32%0%0%
Staphylococcus lugdunensis22.22%0%15.38%0%0%
Staphylococcus pasteuri0%0%3.85%0%0%
Staphylococcus pseudintermedius50%0%64.62%26.67%0%
Staphylococcus saprophyticus5.88%0%3.5%0%0%
Staphylococcus schleiferi36.36%0%0%50%0%
Staphylococcus simulans0%0%1.69%0%0%
Staphylococcus warneri0%0%10.66%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 1250


>gb|WP_057521704.1|+|mecA [Staphylococcus aureus]
MKKIKIVPLILIVVVVGFGIYFYASKDKEINNTIDAIEDKNFKQVYKDSSYISKSDNGEVEMTERPIKIYNSLGVKDINIQDRKIKKVSK
NKKRVDAQYKIKTNYGNIDRNVQFNFVKEDGMWKLDWDHSVIIPGMQKDQSIHIENLKSERGKILDRNNVELANTGTAYEIGIVPKNVSK
KDYKAIAKELSISEDYIKQQMDQNWVQDDTFVPLKTVKKMDEYLSDFAKKFHLTTNETKSRNYPLEKATSHLLGYVGPINSEELKQKEYK
GYKDDAVIGKKGLEKLYDKKLQHEDGYRVTIVDDNSNTIAHTLIEKKKKDGKDIQLTIDAKVQKSIYNNMKNDYGSGTAIHPQTGELLAL
VSTPSYDVYPFMYGMSNEEYNKLTEDKKEPLLNKFQITTSPGSTQKILTAMIGLNNKTLDDKTSYKIDGKGWQKDKSWGGYNVTRYEVVN
GNIDLKQAIESSDNIFFARVALELGSKKFEKGMKKLGVGEDIPSDYPFYNAQISNKNLDNEILLADSGYGQGEILINPVQILSIYSALEN
NGNINAPHLLKDTKNKVWKKNIISKENINLLTDGMQQVVNKTHKEDIYRSYANLIGKSGTAELKMKQGETGRQIGWFISYDKDNPNMMMA
INVKDVQDKGMASYNAKISGKVYDELYENGNKKYDIDE


>gb|NG_047945.1|+|1-2007|mecA [Staphylococcus aureus]
ATGAAAAAGATAAAAATTGTTCCACTTATTTTAATAGTTGTAGTTGTCGGGTTTGGTATATATTTTTATGCTTCAAAAGATAAAGAAATT
AATAATACTATTGATGCAATTGAAGATAAAAATTTCAAACAAGTTTATAAAGATAGCAGTTATATTTCTAAAAGCGATAATGGTGAAGTA
GAAATGACTGAACGTCCGATAAAAATATATAATAGTTTAGGCGTTAAAGATATAAACATTCAGGATCGTAAAATAAAAAAAGTATCTAAA
AATAAAAAACGAGTAGATGCTCAATATAAAATTAAAACAAACTACGGTAACATTGATCGCAACGTTCAATTTAATTTTGTTAAAGAAGAT
GGTATGTGGAAGTTAGATTGGGATCATAGCGTCATTATTCCAGGAATGCAGAAAGACCAAAGCATACATATTGAAAATTTAAAATCAGAA
CGTGGTAAAATTTTAGACCGAAACAATGTGGAATTGGCCAATACAGGAACAGCATATGAGATAGGCATCGTTCCAAAGAATGTATCTAAA
AAAGATTATAAAGCAATCGCTAAAGAACTAAGTATTTCTGAAGACTATATCAAACAACAAATGGATCAAAATTGGGTACAAGATGATACC
TTCGTTCCACTTAAAACCGTTAAAAAAATGGATGAATATTTAAGTGATTTCGCAAAAAAATTTCATCTTACAACTAATGAAACAAAAAGT
CGTAACTATCCTCTAGAAAAAGCGACTTCACATCTATTAGGTTATGTTGGTCCCATTAACTCTGAAGAATTAAAACAAAAAGAATATAAA
GGCTATAAAGATGATGCAGTTATTGGTAAAAAGGGACTCGAAAAACTTTACGATAAAAAGCTCCAACATGAAGATGGCTATCGTGTCACA
ATCGTTGACGATAATAGCAATACAATCGCACATACATTAATAGAGAAAAAGAAAAAAGATGGCAAAGATATTCAACTAACTATTGATGCT
AAAGTTCAAAAGAGTATTTATAACAACATGAAAAATGATTATGGCTCAGGTACTGCTATCCACCCTCAAACAGGTGAATTATTAGCACTT
GTAAGCACACCTTCATATGACGTCTATCCATTTATGTATGGCATGAGTAACGAAGAATATAATAAATTAACCGAAGATAAAAAAGAACCT
CTGCTCAACAAGTTCCAGATTACAACTTCACCAGGTTCAACTCAAAAAATATTAACAGCAATGATTGGGTTAAATAACAAAACATTAGAC
GATAAAACAAGTTATAAAATCGATGGTAAAGGTTGGCAAAAAGATAAATCTTGGGGTGGTTACAACGTTACAAGATATGAAGTGGTAAAT
GGTAATATCGACTTAAAACAAGCAATAGAATCATCAGATAACATTTTCTTTGCTAGAGTAGCACTCGAATTAGGCAGTAAGAAATTTGAA
AAAGGCATGAAAAAACTAGGTGTTGGTGAAGATATACCAAGTGATTATCCATTTTATAATGCTCAAATTTCAAACAAAAATTTAGATAAT
GAAATATTATTAGCTGATTCAGGTTACGGACAAGGTGAAATACTGATTAACCCAGTACAGATCCTTTCAATCTATAGCGCATTAGAAAAT
AATGGCAATATTAACGCACCTCACTTATTAAAAGACACGAAAAACAAAGTTTGGAAGAAAAATATTATTTCCAAAGAAAATATCAATCTA
TTAACTGATGGTATGCAACAAGTCGTAAATAAAACACATAAAGAAGATATTTATAGATCTTATGCAAACTTAATTGGCAAATCCGGTACT
GCAGAACTCAAAATGAAACAAGGAGAAACTGGCAGACAAATTGGGTGGTTTATATCATATGATAAAGATAATCCAAACATGATGATGGCT
ATTAATGTTAAAGATGTACAAGATAAAGGAATGGCTAGCTACAATGCCAAAATCTCAGGTAAAGTGTATGATGAGCTATATGAGAACGGT
AATAAAAAATACGATATAGATGAATAA

Curator Acknowledgements
Curator Description Most Recent Edit