mepR

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3000746
CARD Short NamemepR
DefinitionMepR is an upstream repressor of MepA in Staphylococcus aureus. It is part of the mepRAB operon.
AMR Gene Familymultidrug and toxic compound extrusion (MATE) transporter, antibiotic efflux regulatory protein
Drug Classtetracycline antibiotic, glycylcycline
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Efflux Regulatorprotein(s) or two-component regulatory system modulating antibiotic efflux
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONStaphylococcus aureus (2)
GAZ
FOODON
ENVO
UBERON
Classification11 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ regulates mepA
+ antibiotic efflux regulatory protein [AMR Gene Family]
Resistomes with Perfect MatchesStaphylococcus aureusg+p+wgs
Resistomes with Sequence VariantsStaphylococcus aureusg+p+wgs
Publications

McAleese F, et al. 2005. Antimicrob Agents Chemother 49(5): 1865-1871. A novel MATE family efflux pump contributes to the reduced susceptibility of laboratory-derived Staphylococcus aureus mutants to tigecycline. (PMID 15855508)

Kaatz GW, et al. 2006. Antimicrob Agents Chemother 50(4): 1276-1281. MepR, a repressor of the Staphylococcus aureus MATE family multidrug efflux pump MepA, is a substrate-responsive regulatory protein. (PMID 16569840)

Kaatz GW, et al. 2005. Antimicrob Agents Chemother 49(5): 1857-1864. Multidrug resistance in Staphylococcus aureus due to overexpression of a novel multidrug and toxin extrusion (MATE) transport protein. (PMID 15855507)

Resistomes

Prevalence of mepR among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Escherichia coli0%0%0%0%0%
Staphylococcus aureus99.91%0.11%99%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 250


>gb|BAB56495.1|+|mepR [Staphylococcus aureus subsp. aureus Mu50]
MEFTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKN
IGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ


>gb|BA000017.4|+|379932-380351|mepR [Staphylococcus aureus subsp. aureus Mu50]
ATGGAATTCACTTATTCGTATTTATTTAGAATGATTAGTCATGAGATGAAACAAAAGGCTGATCAAAAGTTAGAGCAATTTGATATTACA
AATGAGCAAGGTCATACGTTAGGTTATCTTTATGCACATCAACAAGATGGACTGACACAAAATGATATTGCTAAAGCATTACAACGAACA
GGTCCAACTGTCAGTAATTTATTAAGGAACCTTGAACGTAAAAAGCTGATCTATCGCTATGTCGATGCACAAGATACGAGAAGAAAGAAT
ATAGGACTGACTACCTCTGGGATTAAACTTGTAGAAGCATTCACTTCGATATTTGATGAAATGGAGCAAACACTCGTATCGCAGTTATCT
GAAGAAGAAAATGAACAAATGAAAGCAAACTTAACTAAAATGTTATCTAGTTTACAATAA

Curator Acknowledgements
Curator Description Most Recent Edit