rmtC

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3000861
CARD Short NamermtC
DefinitionRmtC is a rRNA methyltransferase found in Proteus mirabilis with high level resistance to similar to aminoglycosides, with the exception of non-4,6-disubstituted deoxystreptamines (streptomycin and neomycin). It has also been isolated in Salmonella enterica ser. Virchow. It is hypothesized to methylate G1405, like related methyltransferases RmtA, RmtB, and ArmA.
AMR Gene Family16S rRNA methyltransferase (G1405)
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic target alteration
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONKlebsiella pneumoniae (9), Escherichia coli (7), Enterobacter cloacae (4), Serratia marcescens (3), Acinetobacter baumannii (3), Enterobacter (3), Enterobacteriaceae (3), Citrobacter freundii (2), Pseudomonas aeruginosa (2), Salmonella enterica (2)
GAZAmes (4), Europe (3), China (3), New Delhi (2)
FOODON
ENVOhospital (2)
UBERON
Classification12 ontology terms | Show
Parent Term(s)12 ontology terms | Show
+ confers_resistance_to_antibiotic dibekacin [Antibiotic]
+ confers_resistance_to_antibiotic amikacin [Antibiotic]
+ confers_resistance_to_antibiotic gentamicin C [Antibiotic]
+ confers_resistance_to_antibiotic sisomicin [Antibiotic]
+ confers_resistance_to_antibiotic netilmicin [Antibiotic]
+ confers_resistance_to_antibiotic kanamycin A [Antibiotic]
+ confers_resistance_to_antibiotic tobramycin [Antibiotic]
+ confers_resistance_to_antibiotic isepamicin [Antibiotic]
+ confers_resistance_to_antibiotic G418 [Antibiotic]
+ confers_resistance_to_antibiotic arbekacin [Antibiotic]
+ confers_resistance_to_antibiotic gentamicin B [Antibiotic]
+ 16S rRNA methyltransferase (G1405) [AMR Gene Family]
Resistomes with Perfect MatchesAcinetobacter baumanniiwgs, Aeromonas veroniiwgs, Citrobacter amalonaticuswgs, Citrobacter freundiiwgs, Citrobacter portucalensiswgs, Enterobacter asburiaewgs, Enterobacter cloacaewgs, Enterobacter hormaecheiwgs, Enterobacter kobeiwgs, Enterobacter roggenkampiiwgs, Escherichia colip+wgs, Klebsiella michiganensiswgs, Klebsiella pneumoniaep+wgs, Providencia rettgeriwgs, Salmonella entericap+wgs, Serratia marcescensp+wgs, Shigella sonneiwgs, Vibrio vulnificuswgs
Resistomes with Sequence VariantsAcinetobacter baumanniiwgs, Aeromonas veroniiwgs, Citrobacter amalonaticuswgs, Citrobacter freundiiwgs, Citrobacter portucalensiswgs, Enterobacter asburiaewgs, Enterobacter cloacaewgs, Enterobacter hormaecheiwgs, Enterobacter kobeiwgs, Enterobacter roggenkampiiwgs, Escherichia colip+wgs, Klebsiella michiganensiswgs, Klebsiella pneumoniaep+wgs, Providencia rettgeriwgs, Salmonella entericap+wgs, Serratia marcescensp+wgs, Shigella sonneiwgs, Vibrio vulnificuswgs
Publications

Wachino J, et al. 2005. Antimicrob Agents Chemother 50(1): 178-184. Novel plasmid-mediated 16S rRNA methylase, RmtC, found in a proteus mirabilis isolate demonstrating extraordinary high-level resistance against various aminoglycosides. (PMID 16377684)

Zarubica T, et al. 2011. RNA 17(2): 346-355. The aminoglycoside resistance methyltransferases from the ArmA/Rmt family operate late in the 30S ribosomal biogenesis pathway. (PMID 21177880)

Hopkins KL, et al. 2010. Emerg Infect Dis 16(4): 712-715. 16S rRNA methyltransferase RmtC in Salmonella enterica serovar Virchow. (PMID 20350396)

Rahman M, et al. 2015. Emerging Infect. Dis. 21(11):2059-62 RmtC and RmtF 16S rRNA Methyltransferase in NDM-1-Producing Pseudomonas aeruginosa. (PMID 26488937)

Resistomes

Prevalence of rmtC among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii0%0%0.01%0%0%
Aeromonas veronii0%0%0.56%0%0%
Citrobacter amalonaticus0%0%1.82%0%0%
Citrobacter freundii0%0%0.58%0%0%
Citrobacter portucalensis0%0%0.9%0%0%
Enterobacter asburiae0%0%1.19%0%0%
Enterobacter cloacae0%0%0.32%0%0%
Enterobacter hormaechei0%0%0.65%0%0%
Enterobacter kobei0%0%0.44%0%0%
Enterobacter roggenkampii0%0%0.72%0%0%
Escherichia coli0%0.08%0.15%0%0%
Klebsiella michiganensis0%0%0.27%0%0%
Klebsiella pneumoniae0%0.18%0.62%0%0%
Providencia rettgeri0%0%1.91%0%0%
Salmonella enterica0%0.05%0.01%0%0%
Serratia marcescens0%0.65%0.79%0%0%
Shigella sonnei0%0%0.07%0%0%
Vibrio vulnificus0%0%2.04%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|AIA09786.1|+|rmtC [Pseudomonas aeruginosa]
MKTNDNYIEEVTAKVLTSGKYSTLYPPTVRRVTERLFDRYPPKQLEKEVRKKLHQAYGAYIGGIDGKRLEKKIEKIIHEIPNPTTDEATR
TEWEKEICLKILNLHTSTNERTVAYDELYQKIFEVTGVPTSITDAGCALNPFSFPFFTEAGMLGQYIGFDLDKGMIEAIEHSLRTLNAPE
GIVVKQGDILSDPSGESDLLLMFKLYTLLDRQEEASGLKILQEWKYKNAVISFPIKTISGRDVGMEENYTVKFENDLVGSDLRIMQKLKL
GNEMYFIVSRL


>gb|KJ476816.1|+|80-925|rmtC [Pseudomonas aeruginosa]
ATGAAAACCAACGATAATTATATCGAAGAAGTAACAGCCAAAGTACTCACAAGTGGTAAATACTCCACACTTTATCCACCAACTGTACGA
CGTGTAACTGAGAGGCTTTTCGATCGATACCCTCCCAAGCAGCTAGAGAAGGAGGTTCGCAAGAAATTGCATCAAGCATATGGTGCTTAT
ATTGGTGGGATCGATGGGAAAAGGTTGGAGAAGAAGATTGAGAAGATAATTCATGAGATACCAAATCCAACTACGGATGAAGCAACTCGT
ACGGAGTGGGAAAAAGAGATCTGCCTGAAAATATTGAACTTGCACACTTCAACAAATGAGCGAACGGTGGCTTACGATGAGCTTTACCAA
AAGATCTTTGAGGTAACAGGGGTTCCAACAAGTATCACCGATGCAGGTTGCGCTTTGAATCCATTTTCTTTTCCATTCTTTACGGAGGCT
GGCATGCTTGGGCAATACATAGGTTTCGATCTTGATAAAGGTATGATCGAAGCGATCGAACACTCGTTGAGAACGCTTAACGCCCCAGAG
GGTATTGTTGTCAAACAGGGAGATATATTATCCGATCCGTCAGGCGAGAGTGATCTTCTACTTATGTTCAAGCTATATACTCTACTCGAT
CGGCAGGAAGAGGCCTCTGGTTTGAAAATTCTTCAAGAGTGGAAATACAAAAATGCTGTGATCTCTTTTCCTATTAAAACTATAAGTGGG
AGAGATGTTGGGATGGAAGAGAATTACACTGTTAAGTTCGAGAATGATCTTGTTGGGTCAGATCTGAGAATCATGCAAAAATTGAAATTA
GGAAACGAGATGTATTTTATCGTATCGAGATTGTAA

Curator Acknowledgements
Curator Description Most Recent Edit