OXA-10

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3001405
Synonym(s)PSE-2
CARD Short NameOXA-10
DefinitionOXA-10 is a beta-lactamase found in Acinetobacter baumannii and P. aeruginosa.
AMR Gene FamilyOXA-10-like beta-lactamase
Drug Classpenicillin beta-lactam, cephalosporin
Resistance Mechanismantibiotic inactivation
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONPseudomonas aeruginosa (26), Escherichia coli (7), Pseudomonas (3), Klebsiella pneumoniae (3), Enterobacter cloacae (2), Escherichia (2)
GAZTurkey (2)
FOODON
ENVOhospital (3)
UBERON
Classification16 ontology terms | Show
Parent Term(s)1 ontology terms | Show
+ OXA-10-like beta-lactamase [AMR Gene Family]
Sub-Term(s)
1 ontology terms | Show
+ enmetazobactam [Adjuvant] is_small_molecule_inhibitor_of
Resistomes with Perfect MatchesAchromobacter xylosoxidanswgs, Acinetobacter baumanniig+wgs, Aeromonas caviaeg+wgs+gi, Aeromonas hydrophilag+p+wgs, Aeromonas veroniig+wgs, Citrobacter freundiip+wgs, Citrobacter koseriwgs, Citrobacter portucalensiswgs, Citrobacter werkmaniiwgs, Citrobacter youngaewgs, Enterobacter asburiaewgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiiwgs, Escherichia colig+p+wgs, Escherichia fergusoniip+wgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaep+wgs, Morganella morganiig+wgs, Proteus mirabilisp+wgs, Proteus vulgarisp+wgs, Providencia heimbachaep, Providencia rettgerip+wgs, Providencia stuartiip+wgs, Pseudomonas aeruginosag+p+wgs+gi, Pseudomonas putidap, Salmonella entericap+wgs, Serratia marcescenswgs, Shewanella putrefaciensp, Shigella sonneiwgs, Stenotrophomonas maltophiliag, Stutzerimonas stutzeriwgs, Vibrio alginolyticuswgs, Vibrio choleraewgs, Vibrio fluvialiswgs, Vibrio parahaemolyticuswgs
Resistomes with Sequence VariantsAchromobacter xylosoxidanswgs, Acinetobacter baumanniig+wgs, Acinetobacter pittiiwgs, Aeromonas caviaeg+wgs+gi, Aeromonas hydrophilag+p+wgs, Aeromonas veroniig+wgs, Citrobacter freundiip+wgs, Citrobacter koseriwgs, Citrobacter portucalensiswgs, Citrobacter werkmaniiwgs, Citrobacter youngaewgs, Enterobacter asburiaewgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiiwgs, Escherichia colig+p+wgs, Escherichia fergusoniip+wgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaep+wgs, Morganella morganiig+wgs, Proteus mirabilisp+wgs, Proteus vulgarisp+wgs, Providencia heimbachaep, Providencia rettgerip+wgs, Providencia stuartiip+wgs, Pseudomonas aeruginosag+p+wgs+gi, Pseudomonas putidap, Salmonella entericap+wgs, Serratia marcescenswgs, Shewanella putrefaciensp, Shigella sonneiwgs, Stenotrophomonas maltophiliag, Stutzerimonas stutzeriwgs, Vibrio alginolyticuswgs, Vibrio choleraewgs, Vibrio fluvialiswgs, Vibrio parahaemolyticuswgs
Publications

Paetzel M, et al. 2000. Nat Struct Biol 7(10): 918-925. Crystal structure of the class D beta-lactamase OXA-10. (PMID 11017203)

Simo Tchuinte PL, et al. 2016. Int. J. Antimicrob. Agents : Characterisation of class 3 integrons with oxacillinase gene cassettes in hospital sewage and sludge samples from France and Luxembourg. (PMID 27499434)

Resistomes

Prevalence of OXA-10 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Achromobacter xylosoxidans0%0%3.05%0%0%
Acinetobacter baumannii0.35%0%0.04%0%0%
Acinetobacter pittii0%0%0.28%0%0%
Aeromonas caviae6.82%0%2.15%33.33%0%
Aeromonas hydrophila3.08%2.6%0.81%0%0%
Aeromonas veronii5.45%0%2.25%0%0%
Citrobacter freundii0%0.92%3.68%0%0%
Citrobacter koseri0%0%0.9%0%0%
Citrobacter portucalensis0%0%4.5%0%0%
Citrobacter werkmanii0%0%5.13%0%0%
Citrobacter youngae0%0%6.25%0%0%
Enterobacter asburiae0%0%1.98%0%0%
Enterobacter cloacae0%0.56%0.96%0%0%
Enterobacter hormaechei0%0.13%1.94%0%0%
Enterobacter kobei0%0%1.75%0%0%
Enterobacter roggenkampii0%0%0.72%0%0%
Escherichia coli0.02%0.3%0.93%0%0%
Escherichia fergusonii0%0.71%14.13%0%0%
Klebsiella michiganensis0%0.57%0.53%0%0%
Klebsiella oxytoca0%0.68%0.84%0%0%
Klebsiella pneumoniae0%0.54%1.28%0%0%
Klebsiella quasipneumoniae0%0.64%5.53%0%0%
Morganella morganii5.77%0%3.07%0%0%
Proteus mirabilis0%6.25%1.82%0%0%
Proteus vulgaris0%11.11%5.56%0%0%
Providencia heimbachae0%100%0%0%0%
Providencia rettgeri0%5.41%26.11%0%0%
Providencia stuartii0%13.64%15.91%0%0%
Pseudomonas aeruginosa3.83%1.17%2.69%13.89%0%
Pseudomonas putida0%4%0%0%0%
Salmonella enterica0%0.16%0.2%0%0%
Serratia marcescens0%0%0.52%0%0%
Shewanella putrefaciens0%20%0%0%0%
Shigella sonnei0%0%0.07%0%0%
Stenotrophomonas maltophilia1.12%0%0%0%0%
Stutzerimonas stutzeri0%0%9.16%0%0%
Vibrio alginolyticus0%0%0.4%0%0%
Vibrio cholerae0%0%0.38%0%0%
Vibrio fluvialis0%0%20%0%0%
Vibrio parahaemolyticus0%0%0.1%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|AAG45720.1|+|OXA-10 [Escherichia coli]
MKTFAAYVIIACLSSTALAGSITENTSWNKEFSAEAVNGVFVLCKSSSKSCATNDLARASKEYLPASTFKIPNAIIGLETGVIKNEHQVF
KWDGKPRAMKQWERDLTLRGAIQVSAVPVFQQIAREVGEVRMQKYLKKFSYGNQNISGGIDKFWLEGQLRISAVNQVEFLESLYLNKLSA
SKENQLIVKEALVTEAAPEYLVHSKTGFSGVGTESNPGVAWWVGWVEKETEVYFFAFNMDIDNESKLPLRKSIPTKIMESEGIIGG


>gb|AF205943.1|+|7512-8312|OXA-10 [Escherichia coli]
ATGAAAACATTTGCCGCATATGTAATTATCGCGTGTCTTTCGAGTACGGCATTAGCTGGTTCAATTACAGAAAATACGTCTTGGAACAAA
GAGTTCTCTGCCGAAGCCGTCAATGGTGTCTTCGTGCTTTGTAAAAGTAGCAGTAAATCCTGCGCTACCAATGACTTAGCTCGTGCATCA
AAGGAATATCTTCCAGCATCAACATTTAAGATCCCCAACGCAATTATCGGCCTAGAAACTGGTGTCATAAAGAATGAGCATCAGGTTTTC
AAATGGGACGGAAAGCCAAGAGCCATGAAGCAATGGGAAAGAGACTTGACCTTAAGAGGGGCAATACAAGTTTCAGCTGTTCCCGTATTT
CAACAAATCGCCAGAGAAGTTGGCGAAGTAAGAATGCAGAAATACCTTAAAAAATTTTCCTATGGCAACCAGAATATCAGTGGTGGCATT
GACAAATTCTGGTTGGAAGGCCAGCTTAGAATTTCCGCAGTTAATCAAGTGGAGTTTCTAGAGTCTCTATATTTAAATAAATTGTCAGCA
TCTAAAGAAAACCAGCTAATAGTAAAAGAGGCTTTGGTAACGGAGGCGGCACCTGAATATCTAGTGCATTCAAAAACTGGTTTTTCTGGT
GTGGGAACTGAGTCAAATCCTGGTGTCGCATGGTGGGTTGGGTGGGTTGAGAAGGAGACAGAGGTTTACTTTTTCGCCTTTAACATGGAT
ATAGACAACGAAAGTAAGTTGCCGCTAAGAAAATCCATTCCCACCAAAATCATGGAAAGTGAGGGCATCATTGGTGGCTAA

Curator Acknowledgements
Curator Description Most Recent Edit