OXA-58

Accession ARO:3001611
CARD Short NameOXA-58
DefinitionOXA-58 is a beta-lactamase found in A. baumannii.
AMR Gene FamilyOXA beta-lactamase, OXA-58-like beta-lactamase
Drug Classpenam, carbapenem
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesAcinetobacter baumanniig+p+wgs, Acinetobacter defluviip, Acinetobacter haemolyticusp, Acinetobacter indicusp+wgs, Acinetobacter johnsoniip+wgs, Acinetobacter juniip+wgs, Acinetobacter lwoffiiwgs, Acinetobacter nosocomialisp+wgs, Acinetobacter pittiig+p+wgs, Acinetobacter townerip+wgs, Acinetobacter wuhouensisp+wgs, Klebsiella pneumoniaewgs, Proteus mirabiliswgs
Resistomes with Sequence VariantsAcinetobacter baumanniig+p+wgs, Acinetobacter defluviip, Acinetobacter haemolyticusp, Acinetobacter indicusp+wgs, Acinetobacter johnsoniip+wgs, Acinetobacter juniip+wgs, Acinetobacter lwoffiiwgs, Acinetobacter nosocomialisp+wgs, Acinetobacter pittiig+p+wgs, Acinetobacter townerip+wgs, Acinetobacter wuhouensisp+wgs, Klebsiella pneumoniaewgs, Proteus mirabiliswgs
Classification15 ontology terms | Show
Parent Term(s)1 ontology terms | Show
+ OXA-58-like beta-lactamase [AMR Gene Family]
Publications

Poirel L, et al. 2004. Antimicrob Agents Chemother 49(1): 202-208. OXA-58, a novel class D {beta}-lactamase involved in resistance to carbapenems in Acinetobacter baumannii. (PMID 15616297)

Resistomes

Prevalence of OXA-58 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 413 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Acinetobacter baumannii0.53%1.87%1.4%0%
Acinetobacter defluvii0%12.5%0%0%
Acinetobacter haemolyticus0%2.44%0%0%
Acinetobacter indicus0%13.21%7.79%0%
Acinetobacter johnsonii0%4.17%10.91%0%
Acinetobacter junii0%33.33%5.97%0%
Acinetobacter lwoffii0%0%2.63%0%
Acinetobacter nosocomialis0%1.64%2.87%0%
Acinetobacter pittii2.7%3.94%6.25%0%
Acinetobacter towneri0%37.5%7.69%0%
Acinetobacter wuhouensis0%9.09%50%0%
Klebsiella pneumoniae0%0%0.01%0%
Proteus mirabilis0%0%0.33%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|ACC58995.1|+|OXA-58 [Acinetobacter baumannii ACICU]
MKLLKILSLVCLSISIGACAEHSMSRAKTSTIPQVNNSIIDQNVQALFNEISADAVFVTYDGQNIKKYGTHLDRAKTAYIPASTFKIANA
LIGLENHKATSTEIFKWDGKPRFFKAWDKDFTLGEAMQASTVPVYQELARRIGPSLMQSELQRIGYGNMQIGTEVDQFWLKGPLTITPIQ
EVKFVYDLAQGQLPFKPEVQQQVKEMLYVERRGENRLYAKSGWGMAVDPQVGWYVGFVEKADGQVVAFALNMQMKAGDDIALRKQLSLDV
LDKLGVFHYL


>gb|CP000864.1|+|13384-14226|OXA-58 [Acinetobacter baumannii ACICU]
ATGAAATTATTAAAAATATTGAGTTTAGTTTGCTTAAGCATAAGTATTGGGGCTTGTGCTGAGCATAGTATGAGTCGAGCAAAAACAAGT
ACAATTCCACAAGTGAATAACTCAATCATCGATCAGAATGTTCAAGCGCTTTTTAATGAAATCTCAGCTGATGCTGTGTTTGTCACATAT
GATGGTCAAAATATTAAAAAATATGGCACGCATTTAGACCGAGCAAAAACAGCTTATATTCCTGCATCTACATTTAAAATTGCCAATGCA
CTAATTGGTTTAGAAAATCATAAAGCAACATCTACAGAAATATTTAAGTGGGATGGAAAGCCACGTTTTTTTAAAGCATGGGACAAAGAT
TTTACTTTGGGCGAAGCCATGCAAGCATCTACAGTGCCTGTATATCAAGAATTGGCACGTCGTATTGGTCCAAGCTTAATGCAAAGTGAA
TTGCAACGTATTGGTTATGGCAATATGCAAATAGGCACGGAAGTTGATCAATTTTGGTTGAAAGGGCCTTTGACAATTACACCTATACAA
GAAGTAAAGTTTGTGTATGATTTAGCCCAAGGGCAATTGCCTTTTAAACCTGAAGTTCAGCAACAAGTGAAAGAGATGTTGTATGTAGAG
CGCAGAGGGGAGAATCGTCTATATGCTAAAAGTGGCTGGGGAATGGCTGTAGACCCGCAAGTGGGTTGGTATGTGGGTTTTGTTGAAAAG
GCAGATGGGCAAGTGGTGGCATTTGCTTTAAATATGCAAATGAAAGCTGGTGATGATATTGCTCTACGTAAACAATTGTCTTTAGATGTG
CTAGATAAGTTGGGTGTTTTTCATTATTTATAA