OXA-48

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3001782
CARD Short NameOXA-48
DefinitionOXA-48 is a beta-lactamase found in Klebsiella pneumoniae.
AMR Gene FamilyOXA-48-like beta-lactamase
Drug Classpenicillin beta-lactam, carbapenem
Resistance Mechanismantibiotic inactivation
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONKlebsiella pneumoniae (273), Enterobacteriaceae (143), Escherichia coli (103), Enterobacter cloacae (37), Enterobacterales (21), Acinetobacter baumannii (12), Pseudomonas aeruginosa (11), Serratia marcescens (11), Citrobacter freundii (9), Klebsiella (9)
GAZNew Delhi (24), Turkey (23), Kingdom of Spain (13), Algeria (12), Europe (11), Belgium (7), Saudi Arabia (7), Greece (7), India (7), Tunisia (7)
FOODONwater food product (8), swine (2), Bos taurus (2)
ENVOhospital (63), waste treatment plant (2)
UBERONblood (11), feces (8), membrane organ (6), renal system (3)
Classification17 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic temocillin [Antibiotic]
+ OXA-48-like beta-lactamase [AMR Gene Family]
Sub-Term(s)
3 ontology terms | Show
+ ANT3310 [Adjuvant] is_small_molecule_inhibitor_of
+ xeruborbactam [Adjuvant] is_small_molecule_inhibitor_of
+ taniborbactam [Adjuvant] is_small_molecule_inhibitor_of
Resistomes with Perfect MatchesCitrobacter amalonaticuswgs, Citrobacter freundiip+wgs, Citrobacter koserip+wgs, Citrobacter portucalensiswgs, Citrobacter werkmaniiwgs, Citrobacter youngaewgs, Enterobacter asburiaewgs, Enterobacter chengduensiswgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiip+wgs, Escherichia colig+p+wgs, Klebsiella aerogenesp+wgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaeg+p+wgs+gi, Klebsiella quasipneumoniaewgs, Proteus mirabilisg+wgs, Raoultella planticolawgs, Salmonella entericap, Serratia marcescensp+wgs
Resistomes with Sequence VariantsCitrobacter amalonaticuswgs, Citrobacter freundiip+wgs, Citrobacter koserip+wgs, Citrobacter portucalensiswgs, Citrobacter werkmaniiwgs, Citrobacter youngaewgs, Enterobacter asburiaewgs, Enterobacter chengduensiswgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiip+wgs, Escherichia colig+p+wgs, Klebsiella aerogenesp+wgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaeg+p+wgs+gi, Klebsiella quasipneumoniaewgs, Proteus mirabilisg+wgs, Raoultella planticolawgs, Salmonella entericap, Serratia marcescensp+wgs
Publications

Poirel L, et al. 2003. Antimicrob Agents Chemother 48(1): 15-22. Emergence of oxacillinase-mediated resistance to imipenem in Klebsiella pneumoniae. (PMID 14693513)

Resistomes

Prevalence of OXA-48 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Citrobacter amalonaticus0%0%1.82%0%0%
Citrobacter freundii0%1.54%19.54%0%0%
Citrobacter koseri0%10%3.6%0%0%
Citrobacter portucalensis0%0%0.9%0%0%
Citrobacter werkmanii0%0%2.56%0%0%
Citrobacter youngae0%0%6.25%0%0%
Enterobacter asburiae0%0%7.51%0%0%
Enterobacter chengduensis0%0%4%0%0%
Enterobacter cloacae0%1.12%3.19%0%0%
Enterobacter hormaechei0%0.58%2.89%0%0%
Enterobacter kobei0%0%0.44%0%0%
Enterobacter roggenkampii0%0.48%7.19%0%0%
Escherichia coli0.81%0.24%0.61%0%0%
Klebsiella aerogenes0%1.09%4.24%0%0%
Klebsiella michiganensis0%1.14%3.99%0%0%
Klebsiella oxytoca0%4.11%0.84%0%0%
Klebsiella pneumoniae0.53%1.55%6.16%0.95%0%
Klebsiella quasipneumoniae0%0%1.32%0%0%
Proteus mirabilis1.83%0%0.17%0%0%
Raoultella planticola0%0%2.56%0%0%
Salmonella enterica0%0.33%0%0%0%
Serratia marcescens0%0.65%4.59%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|AAP70012.1|+|OXA-48 [Klebsiella pneumoniae]
MRVLALSAVFLVASIIGMPAVAKEWQENKSWNAHFTEHKSQGVVVLWNENKQQGFTNNLKRANQAFLPASTFKIPNSLIALDLGVVKDEH
QVFKWDGQTRDIATWNRDHNLITAMKYSVVPVYQEFARQIGEARMSKMLHAFDYGNEDISGNVDSFWLDGGIRISATEQISFLRKLYHNK
LHVSERSQRIVKQAMLTEANGDYIIRAKTGYSTRIEPKIGWWVGWVELDDNVWFFAMNMDMPTSDGLGLRQAITKEVLKQEKIIP


>gb|AY236073.2|+|2188-2985|OXA-48 [Klebsiella pneumoniae]
ATGCGTGTATTAGCCTTATCGGCTGTGTTTTTGGTGGCATCGATTATCGGAATGCCTGCGGTAGCAAAGGAATGGCAAGAAAACAAAAGT
TGGAATGCTCACTTTACTGAACATAAATCACAGGGCGTAGTTGTGCTCTGGAATGAGAATAAGCAGCAAGGATTTACCAATAATCTTAAA
CGGGCGAACCAAGCATTTTTACCCGCATCTACCTTTAAAATTCCCAATAGCTTGATCGCCCTCGATTTGGGCGTGGTTAAGGATGAACAC
CAAGTCTTTAAGTGGGATGGACAGACGCGCGATATCGCCACTTGGAATCGCGATCATAATCTAATCACCGCGATGAAATATTCAGTTGTG
CCTGTTTATCAAGAATTTGCCCGCCAAATTGGCGAGGCACGTATGAGCAAGATGCTACATGCTTTCGATTATGGTAATGAGGACATTTCG
GGCAATGTAGACAGTTTCTGGCTCGACGGTGGTATTCGAATTTCGGCCACGGAGCAAATCAGCTTTTTAAGAAAGCTGTATCACAATAAG
TTACACGTATCGGAGCGCAGCCAGCGTATTGTCAAACAAGCCATGCTGACCGAAGCCAATGGTGACTATATTATTCGGGCTAAAACTGGA
TACTCGACTAGAATCGAACCTAAGATTGGCTGGTGGGTCGGTTGGGTTGAACTTGATGATAATGTGTGGTTTTTTGCGATGAATATGGAT
ATGCCCACATCGGATGGTTTAGGGCTGCGCCAAGCCATCACAAAAGAAGTGCTCAAACAGGAAAAAATTATTCCCTAG

Curator Acknowledgements
Curator Description Most Recent Edit