CTX-M-9

Download Sequences

Accession	ARO:3001872
CARD Short Name	CTX-M-9
Definition	CTX-M-9 is a beta-lactamase found in the Enterobacteriaceae family.
AMR Gene Family	CTX-M beta-lactamase
Drug Class	cephalosporin
Resistance Mechanism	antibiotic inactivation
Resistomes with Perfect Matches	Citrobacter freundii^wgs, Citrobacter portucalensis^wgs, Enterobacter asburiae^p+wgs, Enterobacter cloacae^p+wgs, Enterobacter hormaechei^p+wgs, Enterobacter kobei^p+wgs, Enterobacter roggenkampii^p+wgs, Escherichia coli^wgs, Klebsiella michiganensis^wgs, Klebsiella pneumoniae^p+wgs, Klebsiella quasipneumoniae^wgs, Salmonella enterica^wgs, Serratia marcescens^wgs
Resistomes with Sequence Variants	Citrobacter freundii^wgs, Citrobacter portucalensis^wgs, Enterobacter asburiae^p+wgs, Enterobacter cloacae^p+wgs, Enterobacter hormaechei^p+wgs, Enterobacter kobei^p+wgs, Enterobacter roggenkampii^p+wgs, Escherichia coli^wgs, Klebsiella michiganensis^wgs, Klebsiella pneumoniae^p+wgs, Klebsiella quasipneumoniae^wgs, Salmonella enterica^wgs, Serratia marcescens^wgs
Classification	13 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic inactivation [Resistance Mechanism] + antibiotic molecule + hydrolysis of antibiotic conferring resistance + antibiotic inactivation enzyme + beta-lactam antibiotic + hydrolysis of beta-lactam antibiotic by serine beta-lactamase + cephem + beta-lactamase + cephalosporin [Drug Class] + class A beta-lactamase
Parent Term(s)	1 ontology terms \| Show + CTX-M beta-lactamase [AMR Gene Family]
Publications	Chanawong A, et al. 2002. Antimicrob Agents Chemother 46(3): 630-637. Three cefotaximases, CTX-M-9, CTX-M-13, and CTX-M-14, among Enterobacteriaceae in the People's Republic of China. (PMID 11850241)

Resistomes

Prevalence of CTX-M-9 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 413 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI
Citrobacter freundii	0%	0%	2.13%	0%
Citrobacter freundii	0%	0%	2.13%	0%
Citrobacter portucalensis	0%	0%	0.9%	0%
Citrobacter portucalensis	0%	0%	0.9%	0%
Enterobacter asburiae	0%	0.28%	1.58%	0%
Enterobacter asburiae	0%	0.28%	1.58%	0%
Enterobacter cloacae	0%	1.68%	0.64%	0%
Enterobacter cloacae	0%	1.68%	0.64%	0%
Enterobacter hormaechei	0%	0.64%	2.81%	0%
Enterobacter hormaechei	0%	0.64%	2.81%	0%
Enterobacter kobei	0%	1.38%	6.55%	0%
Enterobacter kobei	0%	1.38%	6.55%	0%
Enterobacter roggenkampii	0%	0.97%	3.6%	0%
Enterobacter roggenkampii	0%	0.97%	3.6%	0%
Escherichia coli	0%	0%	0.05%	0%
Escherichia coli	0%	0%	0.05%	0%
Klebsiella michiganensis	0%	0%	0.53%	0%
Klebsiella michiganensis	0%	0%	0.53%	0%
Klebsiella pneumoniae	0%	0.01%	0.15%	0%
Klebsiella pneumoniae	0%	0.01%	0.15%	0%
Klebsiella quasipneumoniae	0%	0%	0.26%	0%
Klebsiella quasipneumoniae	0%	0%	0.26%	0%
Salmonella enterica	0%	0%	0.02%	0%
Salmonella enterica	0%	0%	0.02%	0%
Serratia marcescens	0%	0%	0.39%	0%
Serratia marcescens	0%	0%	0.39%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500

Protein
DNA

>gb|AAF05311.2|+|CTX-M-9 [Escherichia coli]
MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQ
KQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP
RDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQ
QNAESRRDVLASAARIIAEGL

>gb|AF174129.1|+|6336-7211|CTX-M-9 [Escherichia coli]
ATGGTGACAAAGAGAGTGCAACGGATGATGTTCGCGGCGGCGGCGTGCATTCCGCTGCTGCTGGGCAGCGCGCCGCTTTATGCGCAGACG
AGTGCGGTGCAGCAAAAGCTGGCGGCGCTGGAGAAAAGCAGCGGAGGGCGGCTGGGCGTCGCGCTCATCGATACCGCAGATAATACGCAG
GTGCTTTATCGCGGTGATGAACGCTTTCCAATGTGCAGTACCAGTAAAGTTATGGCGGCCGCGGCGGTGCTTAAGCAGAGTGAAACGCAA
AAGCAGCTGCTTAATCAGCCTGTCGAGATCAAGCCTGCCGATCTGGTTAACTACAATCCGATTGCCGAAAAACACGTCAACGGCACAATG
ACGCTGGCAGAGCTGAGCGCGGCCGCGTTGCAGTACAGCGACAATACCGCCATGAACAAATTGATTGCCCAGCTCGGTGGCCCGGGAGGC
GTGACGGCTTTTGCCCGCGCGATCGGCGATGAGACGTTTCGTCTGGATCGCACTGAACCTACGCTGAATACCGCCATTCCCGGCGACCCG
AGAGACACCACCACGCCGCGGGCGATGGCACAGACGTTGCGTCAGCTTACGCTGGGTCATGCGCTGGGCGAAACCCAGCGGGCGCAGTTG
GTGACGTGGCTCAAAGGCAATACGACCGGCGCAGCCAGCATTCGGGCCGGCTTACCGACGTCGTGGACTGCAGGTGATAAGACCGGCAGC
GGCGACTACGGCACCACCAATGATATTGCGGTGATCTGGCCGCAGGGTCGTGCGCCGCTGGTTCTGGTGACCTATTTTACCCAGCCGCAA
CAGAACGCAGAGAGCCGCCGCGATGTGCTGGCTTCAGCGGCGAGAATCATCGCCGAAGGGCTGTAA

CTX-M-9

Prevalence: protein homolog model (view sequences)

Graph