CTX-M-14

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3001877
Synonym(s)CTX-M-18
CARD Short NameCTX-M-14
DefinitionCTX-M-14 is a beta-lactamase found in the Enterobacteriaceae family.
AMR Gene FamilyCTX-M beta-lactamase
Drug Classazole antibiotic, imidazole antibiotic, cephalosporin
Resistance Mechanismantibiotic inactivation
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONEscherichia coli (122), Klebsiella pneumoniae (39), Salmonella (12), Enterobacteriaceae (10), Proteus mirabilis (4), Shigella sonnei (3), Enterobacter cloacae (3), Enterobacter (2), Salmonella enterica (2), Acinetobacter baumannii (2)
GAZChina (6), [Former] State of Korea (5), Kingdom of Spain (5), Japan (3), Hong Kong (3), India (3), Asia (3), Europe (2), England (2), Brazil (2)
FOODONswine (8), chicken (6), Bos taurus (5), dairy cow (2), poultry drumstick (2), meat (skinless) (2)
ENVOhospital (9), farm (8)
UBERONfeces (8), blood (3), renal system (3), animal hemisphere (2)
Classification14 ontology terms | Show
Parent Term(s)1 ontology terms | Show
+ CTX-M beta-lactamase [AMR Gene Family]
Sub-Term(s)
5 ontology terms | Show
+ tazobactam [Adjuvant] is_small_molecule_inhibitor_of
+ clavulanic acid [Adjuvant] is_small_molecule_inhibitor_of
+ vaborbactam [Adjuvant] is_small_molecule_inhibitor_of
+ xeruborbactam [Adjuvant] is_small_molecule_inhibitor_of
+ nacubactam [Adjuvant] is_small_molecule_inhibitor_of
Resistomes with Perfect MatchesAeromonas caviaeg+wgs, Aeromonas hydrophilag+p, Avibacterium paragallinarumwgs, Citrobacter amalonaticusg, Citrobacter freundiig+wgs, Citrobacter portucalensisp, Citrobacter youngaewgs, Cronobacter sakazakiiwgs, Enterobacter asburiaewgs, Enterobacter chengduensiswgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeiwgs, Escherichia albertiiwgs, Escherichia colig+p+wgs+gi, Escherichia fergusoniiwgs, Klebsiella aerogenesp+wgs, Klebsiella huaxiensisg+gi, Klebsiella michiganensisp+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Leclercia adecarboxylatawgs, Proteus mirabilisg+p+wgs, Salmonella entericag+p+wgs+gi, Serratia marcescensg+wgs+gi, Shigella boydiiwgs, Shigella flexnerig+p+wgs, Shigella sonneiwgs, Vibrio alginolyticuswgs, Vibrio choleraeg, Vibrio parahaemolyticusg+wgs
Resistomes with Sequence VariantsAeromonas caviaeg+wgs, Aeromonas hydrophilag+p, Avibacterium paragallinarumwgs, Citrobacter amalonaticusg, Citrobacter freundiig+wgs, Citrobacter portucalensisp, Citrobacter youngaewgs, Cronobacter sakazakiiwgs, Enterobacter asburiaewgs, Enterobacter chengduensiswgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeiwgs, Escherichia albertiiwgs, Escherichia colig+p+wgs+gi, Escherichia fergusoniiwgs, Klebsiella aerogenesp+wgs, Klebsiella huaxiensisg+gi, Klebsiella michiganensisp+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Leclercia adecarboxylatawgs, Proteus mirabilisg+p+wgs, Salmonella entericag+p+wgs+gi, Serratia marcescensg+wgs+gi, Shigella boydiiwgs, Shigella flexnerig+p+wgs, Shigella sonneiwgs, Vibrio alginolyticuswgs, Vibrio choleraeg, Vibrio parahaemolyticusg+wgs
Publications

Chanawong A, et al. 2002. Antimicrob Agents Chemother 46(3): 630-637. Three cefotaximases, CTX-M-9, CTX-M-13, and CTX-M-14, among Enterobacteriaceae in the People's Republic of China. (PMID 11850241)

Resistomes

Prevalence of CTX-M-14 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Aeromonas caviae4.55%0%0.54%0%0%
Aeromonas hydrophila1.54%1.3%0%0%0%
Avibacterium paragallinarum0%0%5.88%0%0%
Citrobacter amalonaticus9.09%0%0%0%0%
Citrobacter freundii0.82%0%0.77%0%0%
Citrobacter portucalensis0%1.47%0%0%0%
Citrobacter youngae0%0%6.25%0%0%
Cronobacter sakazakii0%0%0.22%0%0%
Enterobacter asburiae0%0%1.19%0%0%
Enterobacter chengduensis0%0%4%0%0%
Enterobacter cloacae0%0.56%0.96%0%0%
Enterobacter hormaechei0.36%0.13%0.82%0%0%
Enterobacter kobei0%0%0.44%0%0%
Escherichia albertii0%0%1.94%0%0%
Escherichia coli1.55%0.81%4.27%0.26%0%
Escherichia fergusonii0%0%2.17%0%0%
Klebsiella aerogenes0%1.09%0.56%0%0%
Klebsiella huaxiensis100%0%0%50%0%
Klebsiella michiganensis0%1.14%0.53%0%0%
Klebsiella oxytoca0%0.68%0.84%0%0%
Klebsiella pneumoniae0.53%1.14%3.52%0%0%
Klebsiella quasipneumoniae0%0.21%3.42%0%0%
Leclercia adecarboxylata0%0%4.65%0%0%
Proteus mirabilis5.5%3.75%1.82%0%0%
Salmonella enterica0.5%1.64%0.39%0.33%0%
Serratia marcescens2.27%0%3.01%11.11%0%
Shigella boydii0%0%4.44%0%0%
Shigella flexneri1%0.8%3.42%0%0%
Shigella sonnei0%0%0.73%0%0%
Vibrio alginolyticus0%0%0.4%0%0%
Vibrio cholerae0.45%0%0%0%0%
Vibrio parahaemolyticus0.32%0%1.49%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|AAF72530.1|+|CTX-M-14 [Escherichia coli]
MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQ
KQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP
RDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQ
QNAESRRDVLASAARIIAEGL


>gb|AF252622.2|+|1741-2616|CTX-M-14 [Escherichia coli]
ATGGTGACAAAGAGAGTGCAACGGATGATGTTCGCGGCGGCGGCGTGCATTCCGCTGCTGCTGGGCAGCGCGCCGCTTTATGCGCAGACG
AGTGCGGTGCAGCAAAAGCTGGCGGCGCTGGAGAAAAGCAGCGGAGGGCGGCTGGGCGTCGCGCTCATCGATACCGCAGATAATACGCAG
GTGCTTTATCGCGGTGATGAACGCTTTCCAATGTGCAGTACCAGTAAAGTTATGGCGGCCGCGGCGGTGCTTAAGCAGAGTGAAACGCAA
AAGCAGCTGCTTAATCAGCCTGTCGAGATCAAGCCTGCCGATCTGGTTAACTACAATCCGATTGCCGAAAAACACGTCAACGGCACAATG
ACGCTGGCAGAACTGAGCGCGGCCGCGTTGCAGTACAGCGACAATACCGCCATGAACAAATTGATTGCCCAGCTCGGTGGCCCGGGAGGC
GTGACGGCTTTTGCCCGCGCGATCGGCGATGAGACGTTTCGTCTGGATCGCACTGAACCTACGCTGAATACCGCCATTCCCGGCGACCCG
AGAGACACCACCACGCCGCGGGCGATGGCGCAGACGTTGCGTCAGCTTACGCTGGGTCATGCGCTGGGCGAAACCCAGCGGGCGCAGTTG
GTGACGTGGCTCAAAGGCAATACGACCGGCGCAGCCAGCATTCGGGCCGGCTTACCGACGTCGTGGACTGTGGGTGATAAGACCGGCAGC
GGCGACTACGGCACCACCAATGATATTGCGGTGATCTGGCCGCAGGGTCGTGCGCCGCTGGTTCTGGTGACCTATTTTACCCAGCCGCAA
CAGAACGCAGAGAGCCGCCGCGATGTGCTGGCTTCAGCGGCGAGAATCATCGCCGAAGGGCTGTAA

Curator Acknowledgements
Curator Description Most Recent Edit