IMP-1

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002192
CARD Short NameIMP-1
DefinitionIMP-1 is a beta-lactamase found in Serratia marcescens.
AMR Gene FamilyIMP beta-lactamase
Drug Classpenicillin beta-lactam, cephalosporin, carbapenem
Resistance Mechanismantibiotic inactivation
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONPseudomonas aeruginosa (45), Acinetobacter baumannii (19), Klebsiella pneumoniae (17), Serratia marcescens (16), Acinetobacter (11), Enterobacteriaceae (11), Escherichia coli (11), Enterobacter cloacae (8), Pseudomonas (7), Pseudomonas putida (4)
GAZJapan (17), China (5), Italy (4), New Delhi (4), [Former] State of Korea (3), Brazil (3), Europe (2), Greece (2), Hiroshima (2), Iran (2)
FOODON
ENVOhospital (8)
UBERONurine (3), membrane organ (2)
Classification15 ontology terms | Show
Parent Term(s)1 ontology terms | Show
+ IMP beta-lactamase [AMR Gene Family]
Sub-Term(s)
2 ontology terms | Show
+ taniborbactam [Adjuvant] is_small_molecule_inhibitor_of
+ ME1071 [Adjuvant] is_small_molecule_inhibitor_of
Resistomes with Perfect MatchesAcinetobacter baumanniiwgs, Acinetobacter juniiwgs, Acinetobacter nosocomialiswgs, Acinetobacter pittiiwgs, Aeromonas caviaeg+p+wgs, Aeromonas hydrophilawgs, Citrobacter amalonaticuswgs, Citrobacter freundiiwgs, Enterobacter asburiaeg+p+wgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeip+wgs, Escherichia coliwgs, Klebsiella oxytocawgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaewgs, Morganella morganiiwgs, Providencia rettgerig, Pseudomonas aeruginosag+p+wgs+gi, Pseudomonas putidag+wgs, Stutzerimonas stutzeriwgs
Resistomes with Sequence VariantsAcinetobacter baumanniiwgs, Acinetobacter juniiwgs, Acinetobacter nosocomialiswgs, Acinetobacter pittiiwgs, Aeromonas caviaeg+p+wgs, Aeromonas hydrophilawgs, Citrobacter amalonaticuswgs, Citrobacter freundiiwgs, Enterobacter asburiaeg+p+wgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeip+wgs, Escherichia coliwgs, Klebsiella oxytocawgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaewgs, Morganella morganiiwgs, Providencia rettgerig, Pseudomonas aeruginosag+p+wgs+gi, Pseudomonas putidag+wgs, Stutzerimonas stutzeriwgs
Publications

Osano E, et al. 1994. Antimicrob Agents Chemother 38(1): 71-78. Molecular characterization of an enterobacterial metallo beta-lactamase found in a clinical isolate of Serratia marcescens that shows imipenem resistance. (PMID 8141584)

Resistomes

Prevalence of IMP-1 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii0%0%0.03%0%0%
Acinetobacter junii0%0%2.99%0%0%
Acinetobacter nosocomialis0%0%0.57%0%0%
Acinetobacter pittii0%0%1.14%0%0%
Aeromonas caviae4.55%1.3%24.19%0%0%
Aeromonas hydrophila0%0%0.81%0%0%
Citrobacter amalonaticus0%0%1.82%0%0%
Citrobacter freundii0%0%0.39%0%0%
Enterobacter asburiae3.23%0.83%3.56%0%0%
Enterobacter cloacae0%1.68%6.39%0%0%
Enterobacter hormaechei0.72%3.6%8.59%0%0%
Enterobacter kobei0%0.69%1.31%0%0%
Escherichia coli0%0%0.03%0%0%
Klebsiella oxytoca0%0%0.42%0%0%
Klebsiella pneumoniae0%0.02%0.37%0%0%
Klebsiella quasipneumoniae0%0%0.66%0%0%
Morganella morganii0%0%0.61%0%0%
Providencia rettgeri2.94%0%0%0%0%
Pseudomonas aeruginosa1.38%0.58%0.36%2.78%0%
Pseudomonas putida4.23%0%4.81%0%0%
Stutzerimonas stutzeri0%0%7.63%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400


>gb|CAA11471.1|+|IMP-1 [Pseudomonas aeruginosa]
MSKLSVFFIFLFCSIATAAESLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKG
SISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKP
YGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKKPSKPSN


>gb|AJ223604.1|+|1485-2225|IMP-1 [Pseudomonas aeruginosa]
ATGAGCAAGTTATCTGTATTCTTTATATTTTTGTTTTGCAGCATTGCTACCGCAGCAGAGTCTTTGCCAGATTTAAAAATTGAAAAGCTT
GATGAAGGCGTTTATGTTCATACTTCGTTTGAAGAAGTTAACGGGTGGGGCGTTGTTCCTAAACATGGTTTGGTGGTTCTTGTAAATGCT
GAGGCTTACCTAATTGACACTCCATTTACGGCTAAAGATACTGAAAAGTTAGTCACTTGGTTTGTGGAGCGTGGCTATAAAATAAAAGGC
AGCATTTCCTCTCATTTTCATAGCGACAGCACGGGCGGAATAGAGTGGCTTAATTCTCGATCTATCCCCACGTATGCATCTGAATTAACA
AATGAACTGCTTAAAAAAGACGGTAAGGTTCAAGCCACAAATTCATTTAGCGGAGTTAACTATTGGCTAGTTAAAAATAAAATTGAAGTT
TTTTATCCAGGCCCGGGACACACTCCAGATAACGTAGTGGTTTGGTTGCCTGAAAGGAAAATATTATTCGGTGGTTGTTTTATTAAACCG
TACGGTTTAGGCAATTTGGGTGACGCAAATATAGAAGCTTGGCCAAAGTCCGCCAAATTATTAAAGTCCAAATATGGTAAGGCAAAACTG
GTTGTTCCAAGTCACAGTGAAGTTGGAGACGCATCACTCTTGAAACTTACATTAGAGCAGGCGGTTAAAGGGTTAAACGAAAGTAAAAAA
CCATCAAAACCAAGCAACTAA

Curator Acknowledgements
Curator Description Most Recent Edit