Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002272
CARD Short NameVIM-2
DefinitionVIM-2 is a beta-lactamase found in Pseudomonas spp.
AMR Gene FamilyVIM beta-lactamase
Drug Classpenicillin beta-lactam, cephalosporin, carbapenem
Resistance Mechanismantibiotic inactivation
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONPseudomonas aeruginosa (108), Escherichia coli (15), Acinetobacter baumannii (13), Klebsiella pneumoniae (12), Pseudomonas (10), Enterobacteriaceae (9), Acinetobacter (8), Enterobacter cloacae (5), Pseudomonas putida (5), Citrobacter freundii (3)
GAZ[Former] State of Korea (6), New Delhi (4), Kingdom of Spain (4), Tunisia (3), Europe (3), French (3), India (3), Cairo (2), Egypt (2), Germany (2)
FOODON
ENVOhospital (28)
UBERONurine (3), female organism (2), blood (2), membrane organ (2)
Classification15 ontology terms | Show
Parent Term(s)1 ontology terms | Show
+ VIM beta-lactamase [AMR Gene Family]
Sub-Term(s)
8 ontology terms | Show
+ taniborbactam [Adjuvant] is_small_molecule_inhibitor_of
+ bispicen [Adjuvant] is_small_molecule_inhibitor_of
+ trispicen [Adjuvant] is_small_molecule_inhibitor_of
+ trispicen A [Adjuvant] is_small_molecule_inhibitor_of
+ aspergillomarasmine A [Adjuvant] is_small_molecule_inhibitor_of
+ unithiol [Adjuvant] is_small_molecule_inhibitor_of
+ ANT-431 [Adjuvant] is_small_molecule_inhibitor_of
+ ME1071 [Adjuvant] is_small_molecule_inhibitor_of
Resistomes with Perfect MatchesAcinetobacter pittiip, Alcaligenes faecaliswgs, Citrobacter freundiiwgs, Enterobacter asburiaewgs, Enterobacter hormaecheiwgs, Escherichia coliwgs, Klebsiella pneumoniaewgs, Providencia rettgeriwgs, Pseudomonas aeruginosag+p+wgs+gi, Pseudomonas chlororaphiswgs, Pseudomonas monteiliig+wgs, Pseudomonas putidag+p+wgs, Serratia marcescenswgs, Stutzerimonas stutzerig+p+wgs
Resistomes with Sequence VariantsAcinetobacter pittiip, Alcaligenes faecaliswgs, Citrobacter freundiiwgs, Enterobacter asburiaewgs, Enterobacter hormaecheiwgs, Escherichia coliwgs, Klebsiella pneumoniaewgs, Providencia rettgeriwgs, Pseudomonas aeruginosag+p+wgs+gi, Pseudomonas chlororaphiswgs, Pseudomonas monteiliig+wgs, Pseudomonas putidag+p+wgs, Serratia marcescenswgs, Stutzerimonas stutzerig+p+wgs
Publications

Poirel L, et al. 2000. Antimicrob Agents Chemother 44(4): 891-897. Characterization of VIM-2, a carbapenem-hydrolyzing metallo-beta-lactamase and its plasmid- and integron-borne gene from a Pseudomonas aeruginosa clinical isolate in France. (PMID 10722487)

Resistomes

Prevalence of VIM-2 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter pittii0%0.99%0%0%0%
Alcaligenes faecalis0%0%8.82%0%0%
Citrobacter freundii0%0%0.58%0%0%
Enterobacter asburiae0%0%2.37%0%0%
Enterobacter hormaechei0%0%0.13%0%0%
Escherichia coli0%0%0.01%0%0%
Klebsiella pneumoniae0%0%0.02%0%0%
Providencia rettgeri0%0%1.27%0%0%
Pseudomonas aeruginosa3.22%1.17%5.31%9.72%0%
Pseudomonas chlororaphis0%0%1.61%0%0%
Pseudomonas monteilii22.22%0%21.43%0%0%
Pseudomonas putida1.41%4%3.74%0%0%
Serratia marcescens0%0%4.85%0%0%
Stutzerimonas stutzeri3.57%9.09%5.34%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400


>gb|ABR10840.1|+|VIM-2 [Pseudomonas aeruginosa]
MFKLLSKLLVYLTASIMAIASPLAFSVDSSGEYPTVSEIPVGEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAK
NTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEVEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHS
TDNLVVYVPSASVLYGGCAIYELSRTSAGNVADADLAEWPTSIERIQQHYPEAQFVIPGHGLPGGLDLLKHTTNVVKAHTNRSVVE


>gb|EF614235.1|+|2949-3749|VIM-2 [Pseudomonas aeruginosa]
ATGTTCAAACTTTTGAGTAAGTTATTGGTCTATTTGACCGCGTCTATCATGGCTATTGCGAGTCCGCTCGCTTTTTCCGTAGATTCTAGC
GGTGAGTATCCGACAGTCAGCGAAATTCCGGTCGGGGAGGTCCGGCTTTACCAGATTGCCGATGGTGTTTGGTCGCATATCGCAACGCAG
TCGTTTGATGGCGCAGTCTACCCGTCCAATGGTCTCATTGTCCGTGATGGTGATGAGTTGCTTTTGATTGATACAGCGTGGGGTGCGAAA
AACACAGCGGCACTTCTCGCGGAGATTGAGAAGCAAATTGGACTTCCTGTAACGCGTGCAGTCTCCACGCACTTTCATGACGACCGCGTC
GGCGGCGTTGATGTCCTTCGGGCGGCTGGGGTGGCAACGTACGCATCACCGTCGACACGCCGGCTAGCCGAGGTAGAGGGGAACGAGATT
CCCACGCACTCTCTAGAAGGACTCTCATCGAGCGGGGACGCAGTGCGCTTCGGTCCAGTAGAACTCTTCTATCCTGGTGCTGCGCATTCG
ACCGACAACTTAGTTGTGTACGTCCCGTCTGCGAGTGTGCTCTATGGTGGTTGTGCGATTTATGAGTTGTCACGCACGTCTGCGGGGAAC
GTGGCCGATGCCGATCTGGCTGAATGGCCCACCTCCATTGAGCGGATTCAACAACACTACCCGGAAGCACAGTTCGTCATTCCGGGGCAC
GGCCTGCCGGGCGGTCTAGACTTGCTCAAGCACACAACGAATGTTGTAAAAGCGCACACAAATCGCTCAGTCGTTGAGTAG

Curator Acknowledgements
Curator Description Most Recent Edit