ANT(4')-Ia

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002623
Synonym(s)aadD1
CARD Short NameANT(4')-Ia
DefinitionANT(4')-Ia is a plasmid-encoded aminoglycoside nucleotidyltransferase in S. epidermidis, S. aureus, Enterococcus spp. and Bacillus spp.
AMR Gene FamilyANT(4')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONStaphylococcus aureus (4)
GAZAmes (3)
FOODON
ENVO
UBERON
Classification11 ontology terms | Show
Parent Term(s)5 ontology terms | Show
+ confers_resistance_to_antibiotic dibekacin [Antibiotic]
+ confers_resistance_to_antibiotic amikacin [Antibiotic]
+ confers_resistance_to_antibiotic tobramycin [Antibiotic]
+ confers_resistance_to_antibiotic isepamicin [Antibiotic]
+ ANT(4')-I
Resistomes with Sequence VariantsAliarcobacter butzlerig, Bacillus subtilisg+wgs, Bacillus thuringiensisp+wgs, Bacillus velezensiswgs, Enterococcus faecalisp+wgs, Enterococcus faeciumwgs, Escherichia colip+wgs, Klebsiella pneumoniaewgs, Klebsiella quasipneumoniaep, Providencia alcalifacienswgs, Pseudomonas aeruginosawgs, Staphylococcus arlettaep+wgs, Staphylococcus aureusg+p+wgs, Staphylococcus capitisg+wgs, Staphylococcus epidermidisg+p+wgs, Staphylococcus haemolyticusg+p+wgs, Staphylococcus hominisg+p+wgs, Staphylococcus lugdunensisp, Staphylococcus pasteuriwgs, Staphylococcus pseudintermediuswgs, Staphylococcus saprophyticuswgs, Staphylococcus schleiferig, Staphylococcus warnerip+wgs, Streptococcus suiswgs
Publications

Santanam P and Kayser FH. 1978. J Antibiot (Tokyo) 31(4): 343-351. Purification and characterization of an aminoglycoside inactivating enzyme from Staphylococcus epidermidis FK109 that nucleotidylates the 4'- and 4''-hydroxyl groups of the aminoglycoside antibiotics. (PMID 659332)

McKenzie T, et al. 1986. Plasmid 15(2): 93-103. The nucleotide sequence of pUB110: some salient features in relation to replication and its regulation. (PMID 3010356)

Resistomes

Prevalence of ANT(4')-Ia among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Aliarcobacter butzleri12.5%0%0%0%0%
Bacillus subtilis5.38%0%0.29%0%0%
Bacillus thuringiensis0%0.39%0.35%0%0%
Bacillus velezensis0%0%1.83%0%0%
Enterococcus faecalis0%1.23%2.63%0%0%
Enterococcus faecium0%0%0.27%0%0%
Escherichia coli0%0.01%0.01%0%0%
Klebsiella pneumoniae0%0%0.01%0%0%
Klebsiella quasipneumoniae0%0.21%0%0%0%
Providencia alcalifaciens0%0%3.45%0%0%
Pseudomonas aeruginosa0%0%0.03%0%0%
Staphylococcus arlettae0%8.33%2.5%0%0%
Staphylococcus aureus8.46%4.32%26.45%0%0%
Staphylococcus capitis30%0%26.58%0%0%
Staphylococcus epidermidis5.81%2.59%20%0%0%
Staphylococcus haemolyticus10.34%1.89%13.41%0%0%
Staphylococcus hominis6.25%2.08%21.95%0%0%
Staphylococcus lugdunensis0%3.57%0%0%0%
Staphylococcus pasteuri0%0%3.85%0%0%
Staphylococcus pseudintermedius0%0%0.26%0%0%
Staphylococcus saprophyticus0%0%2.1%0%0%
Staphylococcus schleiferi18.18%0%0%0%0%
Staphylococcus warneri0%7.5%10.66%0%0%
Streptococcus suis0%0%1.31%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|AAA92254.1|+|ANT(4')-Ia [Plasmid pTB913]
MNGPIIMTREERMKIVHEIKERILDKYGDDVKAIGVYGSLGRQTDGPYSDIEMMCVMSTEEAEFSHEWTTGEWKVEVNFDSEEILLDYAS
QVESDWPLTHGQFFSILPIYDSGGYLEKVYQTAKSVEAQKFHDAICALIVEELFEYAGKWRNIRVQGPTTFLPSLTVQVAMAGAMLIGLH
HRICYTTSASVLTEAVKQSDLPSGYDHLCQFVMSGQLSDSEKLLESLENFWNGIQEWTERHGYIVDVSKRIPF


>gb|K02551.1|+|241-1002|ANT(4')-Ia [Plasmid pTB913]
GTGAATGGACCAATAATAATGACTAGAGAAGAAAGAATGAAGATTGTTCATGAAATTAAGGAACGAATATTGGATAAATATGGGGATGAT
GTTAAGGCTATTGGTGTTTATGGCTCTCTTGGTCGTCAGACTGATGGGCCCTATTCGGATATTGAGATGATGTGTGTCATGTCAACAGAG
GAAGCAGAGTTCAGCCATGAATGGACAACCGGTGAGTGGAAGGTGGAAGTGAATTTTGATAGCGAAGAGATTCTACTAGATTATGCATCT
CAGGTGGAATCAGATTGGCCGCTTACACATGGTCAATTTTTCTCTATTTTGCCGATTTATGATTCAGGTGGATACTTAGAGAAAGTGTAT
CAAACTGCTAAATCGGTAGAAGCCCAAAAGTTCCACGATGCGATTTGTGCCCTTATCGTAGAAGAGCTGTTTGAATATGCAGGCAAATGG
CGTAATATTCGTGTGCAAGGACCGACAACATTTCTACCATCCTTGACTGTACAGGTAGCAATGGCAGGTGCCATGTTGATTGGTCTGCAT
CATCGCATCTGTTATACGACGAGCGCTTCGGTCTTAACTGAAGCAGTTAAGCAATCAGATCTTCCTTCAGGTTATGACCATCTGTGCCAG
TTCGTAATGTCTGGTCAACTTTCCGACTCTGAGAAACTTCTGGAATCGCTAGAGAATTTCTGGAATGGGATTCAGGAGTGGACAGAACGA
CACGGATATATAGTGGATGTGTCAAAACGCATACCATTTTGA

Curator Acknowledgements
Curator Description Most Recent Edit