catA1

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002683
Synonym(s)cat1 catI
CARD Short NamecatA1
DefinitioncatA1 (formerly in CARD as catI) is a chromosome and transposon-encoded variant of the cat gene found in Escherichia coli and Acinetobacter baumannii.
AMR Gene Familychloramphenicol acetyltransferase (CAT)
Drug Classphenicol antibiotic
Resistance Mechanismantibiotic inactivation
Classification8 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ chloramphenicol acetyltransferase (CAT) [AMR Gene Family]
+ confers_resistance_to_antibiotic azidamfenicol [Antibiotic]
+ confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
+ confers_resistance_to_antibiotic thiamphenicol [Antibiotic]
Resistomes with Perfect MatchesAcinetobacter baumanniig+wgs+gi, Aeromonas caviaeg+wgs, Aeromonas hydrophilag+p, Alcaligenes faecaliswgs, Burkholderia malleiwgs, Citrobacter freundiig+p+wgs, Citrobacter koseriwgs, Citrobacter portucalensisg+wgs, Citrobacter werkmaniiwgs, Comamonas testosteroniwgs, Cronobacter sakazakiiwgs, Cupriavidus metalliduranswgs, Enterobacter asburiaep+wgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiiwgs, Enterococcus faecaliswgs, Escherichia albertiig, Escherichia colig+p+wgs+gi, Escherichia fergusoniip+wgs, Helicobacter pylorig, Klebsiella aerogeneswgs, Klebsiella michiganensisg+wgs, Klebsiella oxytocag+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaewgs, Leclercia adecarboxylatawgs, Morganella morganiig+wgs, Neisseria gonorrhoeaewgs, Proteus mirabilisg+wgs+gi, Proteus vulgariswgs, Providencia rettgerip+wgs, Pseudomonas aeruginosawgs, Salmonella entericag+p+wgs+gi, Serratia liquefacienswgs, Serratia marcescensg+wgs, Shigella boydiiwgs, Shigella dysenteriaeg+p+wgs+gi, Shigella flexnerig+p+wgs+gi, Shigella sonneiwgs, Streptococcus agalactiaeg, Streptococcus mutansp, Vibrio choleraep, Vibrio parahaemolyticuswgs
Resistomes with Sequence VariantsAcinetobacter baumanniig+p+wgs+gi, Aeromonas caviaeg+wgs, Aeromonas hydrophilag+p, Alcaligenes faecaliswgs, Bacillus cereuswgs, Bacillus thuringiensiswgs, Burkholderia malleiwgs, Citrobacter freundiig+p+wgs, Citrobacter koseriwgs, Citrobacter portucalensisg+wgs, Citrobacter werkmaniiwgs, Comamonas testosteroniwgs, Cronobacter sakazakiiwgs, Cupriavidus metalliduranswgs, Enterobacter asburiaep+wgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiip+wgs, Enterococcus faecaliswgs, Escherichia albertiig, Escherichia colig+p+wgs+gi, Escherichia fergusoniip+wgs, Helicobacter pylorig, Klebsiella aerogeneswgs, Klebsiella michiganensisg+wgs, Klebsiella oxytocag+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Leclercia adecarboxylatawgs, Legionella pneumophilawgs, Listeria monocytogeneswgs, Morganella morganiig+wgs, Neisseria gonorrhoeaewgs, Proteus mirabilisg+wgs+gi, Proteus vulgariswgs, Providencia rettgerip+wgs, Pseudomonas aeruginosawgs, Pseudomonas putidawgs, Salmonella entericag+p+wgs+gi, Serratia liquefacienswgs, Serratia marcescensg+wgs, Shigella boydiiwgs, Shigella dysenteriaeg+p+wgs+gi, Shigella flexnerig+p+wgs+gi, Shigella sonneiwgs, Staphylococcus aureuswgs, Streptococcus agalactiaeg, Streptococcus mutansp, Vibrio choleraep+wgs, Vibrio parahaemolyticuswgs, Yersinia pestiswgs
Publications

Alton NK and Vapnek D. 1979. Nature 282(5741): 864-869. Nucleotide sequence analysis of the chloramphenicol resistance transposon Tn9. (PMID 390403)

Elisha BG, et al. 1991. Plasmid 25(2): 96-104. Identification of an Acinetobacter baumannii gene region with sequence and organizational similarity to Tn2670. (PMID 1650008)

Resistomes

Prevalence of catA1 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii4.07%0.05%3.14%2.52%0%
Aeromonas caviae2.27%0%1.08%0%0%
Aeromonas hydrophila1.54%1.3%0%0%0%
Alcaligenes faecalis0%0%2.94%0%0%
Bacillus cereus0%0%0.1%0%0%
Bacillus thuringiensis0%0%0.17%0%0%
Burkholderia mallei0%0%1.19%0%0%
Citrobacter freundii1.64%0.62%4.84%0%0%
Citrobacter koseri0%0%0.9%0%0%
Citrobacter portucalensis3.7%0%7.21%0%0%
Citrobacter werkmanii0%0%12.82%0%0%
Comamonas testosteroni0%0%7.14%0%0%
Cronobacter sakazakii0%0%0.22%0%0%
Cupriavidus metallidurans0%0%11.11%0%0%
Enterobacter asburiae0%0.55%7.51%0%0%
Enterobacter cloacae0%2.79%6.71%0%0%
Enterobacter hormaechei0%1.35%10.49%0%0%
Enterobacter kobei0%0%9.17%0%0%
Enterobacter roggenkampii0%0.48%3.96%0%0%
Enterococcus faecalis0%0%0.04%0%0%
Escherichia albertii1.43%0%0%0%0%
Escherichia coli2.43%0.47%6.03%0.64%0.31%
Escherichia fergusonii0%0.36%1.09%0%0%
Helicobacter pylori1.03%0%0%0%0%
Klebsiella aerogenes0%0%0.28%0%0%
Klebsiella michiganensis8.06%0%1.06%0%0%
Klebsiella oxytoca2.56%0%14.71%0%0%
Klebsiella pneumoniae0.83%2.23%16.34%0%0%
Klebsiella quasipneumoniae0%0.21%6.58%0%0%
Leclercia adecarboxylata0%0%2.33%0%0%
Legionella pneumophila0%0%0.22%0%0%
Listeria monocytogenes0%0%0.12%0%0%
Morganella morganii23.08%0%17.79%0%0%
Neisseria gonorrhoeae0%0%0.44%0%0%
Proteus mirabilis18.35%0%17.82%3.7%0%
Proteus vulgaris0%0%5.56%0%0%
Providencia rettgeri0%5.41%1.27%0%0%
Pseudomonas aeruginosa0%0%0.1%0%0%
Pseudomonas putida0%0%0.53%0%0%
Salmonella enterica2.02%1.64%4.06%7.95%0%
Serratia liquefaciens0%0%3.17%0%0%
Serratia marcescens0.76%0%4.33%0%0%
Shigella boydii0%0%6.67%0%0%
Shigella dysenteriae21.43%13.64%30%25%0%
Shigella flexneri45%0.4%80.43%16.67%0%
Shigella sonnei0%0%8.55%0%0%
Staphylococcus aureus0%0%0.02%0%0%
Streptococcus agalactiae0.93%0%0%0%0%
Streptococcus mutans0%33.33%0%0%0%
Vibrio cholerae0%5.26%0.06%0%0%
Vibrio parahaemolyticus0%0%0.1%0%0%
Yersinia pestis0%0%0.2%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400


>gb|CAA23899.1|+|catA1 [Escherichia coli]
MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFLKTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHP
CYTVFHEQTETFSSLWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANMDNFFAPVFTMGKYYTQG
DKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA


>gb|V00622.1|+|244-903|catA1 [Escherichia coli]
ATGGAGAAAAAAATCACTGGATATACCACCGTTGATATATCCCAATGGCATCGTAAAGAACATTTTGAGGCATTTCAGTCAGTTGCTCAA
TGTACCTATAACCAGACCGTTCAGCTGGATATTACGGCCTTTTTAAAGACCGTAAAGAAAAATAAGCACAAGTTTTATCCGGCCTTTATT
CACATTCTTGCCCGCCTGATGAATGCTCATCCGGAATTCCGTATGGCAATGAAAGACGGTGAGCTGGTGATATGGGATAGTGTTCACCCT
TGTTACACCGTTTTCCATGAGCAAACTGAAACGTTTTCATCGCTCTGGAGTGAATACCACGACGATTTCCGGCAGTTTCTACACATATAT
TCGCAAGATGTGGCGTGTTACGGTGAAAACCTGGCCTATTTCCCTAAAGGGTTTATTGAGAATATGTTTTTCGTCTCAGCCAATCCCTGG
GTGAGTTTCACCAGTTTTGATTTAAACGTGGCCAATATGGACAACTTCTTCGCCCCCGTTTTCACCATGGGCAAATATTATACGCAAGGC
GACAAGGTGCTGATGCCGCTGGCGATTCAGGTTCATCATGCCGTCTGTGATGGCTTCCATGTCGGCAGAATGCTTAATGAATTACAACAG
TACTGCGATGAGTGGCAGGGCGGGGCGTAA

Curator Acknowledgements
Curator Description Most Recent Edit