lnuB

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002836
Synonym(s)linB
CARD Short NamelnuB
DefinitionlnuB is a plasmid-mediated nucleotidyltransferase found in Streptococcus lutetiensis.
AMR Gene Familylincosamide nucleotidyltransferase (LNU)
Drug Classlincosamide antibiotic
Resistance Mechanismantibiotic inactivation
Classification8 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic lincomycin [Antibiotic]
+ confers_resistance_to_antibiotic clindamycin [Antibiotic]
+ lincosamide nucleotidyltransferase (LNU) [AMR Gene Family]
Resistomes with Sequence VariantsCampylobacter coliwgs, Campylobacter jejuniwgs, Enterococcus faecalisg+p+wgs, Enterococcus faeciump+wgs, Enterococcus hiraeg+p+wgs, Erysipelothrix rhusiopathiaeg, Jeotgalibaca arthritidisg, Klebsiella pneumoniaewgs, Listeria innocuap, Staphylococcus aureusg+p+wgs, Staphylococcus epidermidiswgs, Staphylococcus pseudintermediuswgs, Staphylococcus saprophyticusp+wgs, Streptococcus agalactiaeg+wgs, Streptococcus dysgalactiaeg+wgs, Streptococcus equiwgs, Streptococcus gallolyticusg+wgs, Streptococcus lutetiensiswgs, Streptococcus pasteurianusg+wgs, Streptococcus porcinuswgs, Streptococcus suisg+wgs, Streptococcus uberiswgs
Publications

Almuzara M, et al. 2013. J Clin Microbiol 51(12): 4259-4261. First case of Streptococcus lutetiensis bacteremia involving a clindamycin-resistant isolate carrying the lnuB gene. (PMID 24048528)

Bozdogan B, et al. 1999. Antimicrob Agents Chemother 43(4): 925-929. A new resistance gene, linB, conferring resistance to lincosamides by nucleotidylation in Enterococcus faecium HM1025. (PMID 10103201)

Resistomes

Prevalence of lnuB among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Campylobacter coli0%0%0.09%0%0%
Campylobacter jejuni0%0%0.05%0%0%
Enterococcus faecalis5.45%2.96%6.28%0%0%
Enterococcus faecium0%2.78%8.18%0%0%
Enterococcus hirae7.69%7.14%5.09%0%0%
Erysipelothrix rhusiopathiae27.27%0%0%0%0%
Jeotgalibaca arthritidis100%0%0%0%0%
Klebsiella pneumoniae0%0%0.01%0%0%
Listeria innocua0%10.53%0%0%0%
Staphylococcus aureus2.36%0.04%2.92%0%0%
Staphylococcus epidermidis0%0%0.08%0%0%
Staphylococcus pseudintermedius0%0%0.77%0%0%
Staphylococcus saprophyticus0%2.7%1.4%0%0%
Streptococcus agalactiae4.67%0%4.38%0%0%
Streptococcus dysgalactiae2%0%2.8%0%0%
Streptococcus equi0%0%0.23%0%0%
Streptococcus gallolyticus10%0%6.82%0%0%
Streptococcus lutetiensis0%0%2.04%0%0%
Streptococcus pasteurianus50%0%15%0%0%
Streptococcus porcinus0%0%33.33%0%0%
Streptococcus suis6.4%0%4.88%0%0%
Streptococcus uberis0%0%4.46%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|CAB41414.1|+|lnuB [Enterococcus faecium]
MLKQKELIANVKNLTESDERITACMMYGSFTKGEGDQYSDIEFYIFLKHSITSNFDSSNWLFDVAPYLMLYKNEYGTEVVIFDNLIRGEF
HFLSEKDMNIIPSFKDSGYIPDTKAMLIYDETGQLENYLSEISGARPNRLTEENANFLLCNFSNLWLMGINVLKRGEYARSLELLSQLQK
NTLQLIRMAEKNADNWLNMSKNLEKEISLENYKKFAKTTARLDKVELFEAYKNSLLLVMDLQSHLIEQYNLKVTHDILERLLNYISE


>gb|AJ238249.1|+|127-930|lnuB [Enterococcus faecium]
ATGTTAAAACAAAAAGAATTAATTGCAAACGTTAAGAATCTTACTGAGTCAGATGAACGAATTACAGCTTGTATGATGTATGGATCGTTT
ACCAAAGGAGAAGGTGACCAATACTCTGATATAGAGTTCTATATATTTTTGAAACATAGTATAACCTCGAACTTTGATTCATCCAACTGG
TTGTTTGACGTAGCTCCGTACTTGATGCTTTATAAAAATGAGTACGGAACAGAGGTAGTTATTTTTGATAATCTTATACGTGGGGAATTT
CATTTCCTTTCTGAAAAAGATATGAACATAATCCCCTCGTTTAAAGATTCAGGTTATATTCCTGATACGAAGGCTATGCTTATTTACGAT
GAAACAGGGCAATTAGAAAATTATTTATCAGAGATAAGTGGTGCAAGACCAAATAGACTTACTGAAGAAAATGCTAATTTTTTGTTGTGT
AATTTCTCTAATCTATGGTTGATGGGAATCAACGTTCTAAAAAGAGGAGAATATGCTCGTTCATTAGAACTCTTATCACAACTTCAAAAA
AATACACTACAACTTATACGTATGGCAGAAAAAAATGCTGATAATTGGCTAAACATGAGTAAAAACCTTGAAAAAGAAATTAGCCTTGAA
AATTATAAAAAATTTGCAAAGACCACTGCTCGATTAGATAAGGTAGAATTATTTGAAGCCTATAAAAATTCTTTGCTATTAGTTATGGAT
TTGCAAAGTCACCTTATTGAACAATACAACTTAAAAGTTACACATGACATTTTAGAAAGATTGTTGAATTACATTAGTGAATAG

Curator Acknowledgements
Curator Description Most Recent Edit