dfrA1

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002854
Synonym(s)dfr1 dhfrI
CARD Short NamedfrA1
DefinitiondfrA1 is an integron-encoded dihydrofolate reductase.
AMR Gene Familytrimethoprim resistant dihydrofolate reductase dfr
Drug Classdiaminopyrimidine antibiotic
Resistance Mechanismantibiotic target replacement
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONEscherichia coli (20), Salmonella (9), Vibrio cholerae (6), Salmonella enterica (6), Klebsiella pneumoniae (4), Salmonella enterica subsp. enterica serovar Typhimurium str. DT104 (3), Shigella (2), Enterobacter cloacae (2), Shigella sonnei (2)
GAZ
FOODONwater food product (6), chicken (4)
ENVO
UBERONanimal hemisphere (2)
Classification15 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic trimethoprim [Antibiotic]
+ derives_from antibiotic sensitive dihydrofolate reductase
+ trimethoprim resistant dihydrofolate reductase dfr [AMR Gene Family]
Resistomes with Perfect MatchesAeromonas caviaewgs, Aeromonas hydrophilap, Alcaligenes faecaliswgs, Citrobacter amalonaticuswgs, Citrobacter freundiig+wgs, Citrobacter portucalensiswgs, Citrobacter werkmaniiwgs, Enterobacter asburiaewgs, Enterobacter cloacaewgs, Enterobacter hormaecheip+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiiwgs, Escherichia colig+p+wgs, Escherichia fergusoniip+wgs, Klebsiella aerogenesp, Klebsiella michiganensisp+wgs, Klebsiella oxytocawgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaewgs, Proteus mirabilisg+wgs, Providencia heimbachaep, Providencia rettgeriwgs, Providencia stuartiiwgs, Pseudomonas aeruginosawgs, Pseudomonas monteiliiwgs, Raoultella planticolawgs, Salmonella entericag+p+wgs, Serratia marcescensp+wgs, Shigella dysenteriaep+wgs, Shigella flexnerig+p+wgs, Shigella sonneiwgs
Resistomes with Sequence VariantsAcinetobacter baumanniig+p+wgs, Acinetobacter lwoffiiwgs, Acinetobacter pittiip+wgs, Acinetobacter townerip+wgs, Actinobacillus pleuropneumoniaeg+wgs, Aeromonas caviaewgs, Aeromonas hydrophilap+wgs, Aeromonas veroniiwgs, Alcaligenes faecaliswgs, Burkholderia cenocepaciawgs, Citrobacter amalonaticuswgs, Citrobacter freundiig+wgs, Citrobacter portucalensisg+wgs, Citrobacter werkmaniiwgs, Citrobacter youngaewgs, Corynebacterium diphtheriaeg+wgs, Enterobacter asburiaewgs, Enterobacter cloacaeg+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiiwgs, Escherichia albertiiwgs, Escherichia colig+p+wgs, Escherichia fergusoniip+wgs, Klebsiella aerogenesp+wgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocag+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Laribacter hongkongensiswgs, Morganella morganiig+wgs, Pasteurella multocidag+wgs, Plesiomonas shigelloideswgs, Proteus columbaeg, Proteus mirabilisg+p+wgs, Proteus penneriwgs, Proteus vulgarisg+wgs, Providencia alcalifaciensg, Providencia heimbachaeg+p+wgs, Providencia rettgerig+p+wgs, Providencia stuartiig+wgs, Pseudomonas aeruginosap+wgs, Pseudomonas monteiliiwgs, Raoultella planticolawgs, Salmonella entericag+p+wgs, Serratia liquefacienswgs, Serratia marcescensp+wgs, Shewanella putrefaciensp, Shigella boydiig+wgs, Shigella dysenteriaeg+p+wgs, Shigella flexnerig+p+wgs, Shigella sonneig+p+wgs, Stutzerimonas stutzeriwgs, Vibrio choleraeg+wgs, Vibrio vulnificuswgs, Yersinia enterocoliticawgs
Publications

Saenz Y, et al. 2004. Antimicrob Agents Chemother 48(10): 3996-4001. Mechanisms of resistance in multiple-antibiotic-resistant Escherichia coli strains of human, animal, and food origins. (PMID 15388464)

Resistomes

Prevalence of dfrA1 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii1.59%0.36%4.27%0%0%
Acinetobacter lwoffii0%0%2.63%0%0%
Acinetobacter pittii0%0.49%0.85%0%0%
Acinetobacter towneri0%18.75%7.69%0%0%
Actinobacillus pleuropneumoniae2.78%0%4.76%0%0%
Aeromonas caviae0%0%3.23%0%0%
Aeromonas hydrophila0%1.3%0.81%0%0%
Aeromonas veronii0%0%0.56%0%0%
Alcaligenes faecalis0%0%14.71%0%0%
Burkholderia cenocepacia0%0%0.22%0%0%
Citrobacter amalonaticus0%0%1.82%0%0%
Citrobacter freundii14.75%0%24.76%0%0%
Citrobacter portucalensis7.41%0%6.31%0%0%
Citrobacter werkmanii0%0%53.85%0%0%
Citrobacter youngae0%0%6.25%0%0%
Corynebacterium diphtheriae1.85%0%0.31%0%0%
Enterobacter asburiae0%0%4.35%0%0%
Enterobacter cloacae3.57%0%12.46%0%0%
Enterobacter hormaechei0.36%0.84%6.91%0%0%
Enterobacter kobei0%0%4.8%0%0%
Enterobacter roggenkampii0%0%5.4%0%0%
Escherichia albertii0%0%0.65%0%0%
Escherichia coli1.36%0.51%6.02%0%7.89%
Escherichia fergusonii0%1.07%4.35%0%0%
Klebsiella aerogenes0%2.17%0.28%0%0%
Klebsiella michiganensis0%0.57%2.66%0%0%
Klebsiella oxytoca5.13%0%13.03%0%0%
Klebsiella pneumoniae0.24%1.13%6.83%0%0%
Klebsiella quasipneumoniae0%0.85%3.82%0%0%
Laribacter hongkongensis0%0%8.33%0%0%
Morganella morganii17.31%0%13.5%0%0%
Pasteurella multocida0.71%0%1.12%0%0%
Plesiomonas shigelloides0%0%3.45%0%0%
Proteus columbae100%0%0%0%0%
Proteus mirabilis43.12%3.75%59.74%0%0%
Proteus penneri0%0%12.5%0%0%
Proteus vulgaris18.18%0%22.22%0%0%
Providencia alcalifaciens9.09%0%0%0%0%
Providencia heimbachae50%100%14.29%0%0%
Providencia rettgeri47.06%5.41%19.11%0%0%
Providencia stuartii18.75%0%27.27%0%0%
Pseudomonas aeruginosa0%0.29%0.36%0%0%
Pseudomonas monteilii0%0%2.38%0%0%
Raoultella planticola0%0%2.56%0%0%
Salmonella enterica0.76%0.55%1.36%0%0%
Serratia liquefaciens0%0%1.59%0%0%
Serratia marcescens0%0.65%6.82%0%0%
Shewanella putrefaciens0%20%0%0%0%
Shigella boydii13.33%0%23.33%0%0%
Shigella dysenteriae21.43%4.55%23.33%0%0%
Shigella flexneri20%0.8%63.82%0%0%
Shigella sonnei70.73%0.97%76.41%0%0%
Stutzerimonas stutzeri0%0%3.82%0%0%
Vibrio cholerae6.73%0%35.78%0%0%
Vibrio vulnificus0%0%0.41%0%0%
Yersinia enterocolitica0%0%5.45%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 300


>gb|AAP74961.2|+|dfrA1 [Klebsiella oxytoca]
MKLSLMVAISKNGVIGNGPDIPWSAKGEQLLFKAITYNQWLLVGRKTFESMGALPNRKYAVVTRSSFTSDNENVVIFPSIKDALTNLKKI
TDHVIVSGGGEIYKSLIDQVDTLHISTIDIEPEGDVYFPEIPSNFRPVFTQDFASNINYSYQIWQKG


>gb|KJ541681.1|+|19527-20000|dfrA1 [Klebsiella oxytoca]
GTGAAACTATCACTAATGGTAGCTATATCGAAGAATGGAGTTATCGGGAATGGCCCTGATATTCCATGGAGTGCCAAAGGTGAACAGCTC
CTGTTTAAAGCTATTACCTATAACCAATGGCTGTTGGTTGGACGCAAGACTTTTGAATCAATGGGAGCATTACCCAACCGAAAGTATGCG
GTCGTAACACGTTCAAGTTTTACATCTGACAATGAGAACGTAGTGATCTTTCCATCAATTAAAGATGCTTTAACCAACCTAAAGAAAATA
ACGGATCATGTCATTGTTTCAGGTGGTGGGGAGATATACAAAAGCCTGATCGATCAAGTAGATACACTACATATATCTACAATAGACATC
GAGCCGGAAGGTGATGTTTACTTTCCTGAAATCCCCAGCAATTTTAGGCCAGTTTTTACCCAAGACTTCGCCTCTAACATAAATTATAGT
TACCAAATCTGGCAAAAGGGTTAA

Curator Acknowledgements
Curator Description Most Recent Edit