Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3003035
CARD Short NamemfpA
DefinitionmfpA is a qnr homolog and a pentapeptide repeat protein that confers resistance to fluoroquinolones in Mycolicibacterium smegmatis.
AMR Gene Familyquinolone resistance protein (qnr)
Drug Classfluoroquinolone antibiotic
Resistance Mechanismantibiotic target protection
Classification14 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic ciprofloxacin [Antibiotic]
+ quinolone resistance protein (qnr) [AMR Gene Family]
+ confers_resistance_to_antibiotic sparfloxacin [Antibiotic]
Resistomes with Perfect MatchesMycobacterium tuberculosisg+wgs
Resistomes with Sequence VariantsMycobacterium tuberculosisg+wgs
Publications

Hegde SS, et al. 2005. Science 308(5727): 1480-1483. A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. (PMID 15933203)

Resistomes

Prevalence of mfpA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Mycobacterium tuberculosis100%0%93.08%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 350


>gb|CCP46182.1|-|mfpA [Mycobacterium tuberculosis H37Rv]
MQQWVDCEFTGRDFRDEDLSRLHTERAMFSECDFSGVNLAESQHRGSAFRNCTFERTTLWHSTFAQCSMLGSVFVACRLRPLTLDDVDFT
LAVLGGNDLRGLNLTGCRLRETSLVDTDLRKCVLRGADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCL
AGG


>gb|AL123456.1|-|3773016-3773567|mfpA [Mycobacterium tuberculosis H37Rv]
TTGCAGCAGTGGGTTGATTGCGAATTCACCGGTCGAGACTTCCGCGACGAGGACCTTAGCCGCCTGCACACCGAACGGGCGATGTTCAGC
GAATGCGATTTCAGCGGCGTGAATCTGGCCGAGTCACAACACCGAGGGTCGGCGTTTCGTAATTGCACCTTCGAACGGACGACACTGTGG
CACAGCACATTTGCCCAGTGCAGCATGTTGGGCTCGGTCTTCGTGGCTTGCCGGCTGCGGCCGCTGACGTTGGACGACGTGGATTTCACG
CTCGCCGTGCTCGGCGGAAATGATCTGCGTGGTCTCAACTTGACCGGCTGCCGGTTGCGAGAGACCAGCCTGGTGGATACCGACTTGCGC
AAGTGCGTGCTGCGCGGCGCCGACCTCAGTGGTGCCCGTACCACGGGCGCCCGGCTGGATGACGCCGACTTGCGGGGCGCGACCGTGGAC
CCGGTATTGTGGCGGACCGCGTCGTTGGTGGGTGCGCGTGTCGACGTCGACCAAGCCGTGGCCTTTGCGGCGGCGCACGGGCTGTGCTTG
GCAGGGGGCTAG

Curator Acknowledgements
Curator Description Most Recent Edit