Escherichia coli emrE

Download Sequences


Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3004039
CARD Short NameEcol_emrE
DefinitionMember of the small MDR (multidrug resistance) family of transporters; in Escherichia coli this protein provides resistance against a number of positively charged compounds including ethidium bromide and erythromycin; proton-dependent secondary transporter which exchanges protons for compound translocation.
AMR Gene Familysmall multidrug resistance (SMR) antibiotic efflux pump
Drug Classmacrolide antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Classification8 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic erythromycin [Antibiotic]
+ emrE
Resistomes with Perfect MatchesEscherichia albertiig, Escherichia colig+wgs, Escherichia marmotaewgs
Resistomes with Sequence VariantsCitrobacter werkmaniiwgs, Enterobacter roggenkampiiwgs, Escherichia albertiig+wgs, Escherichia colig+p+wgs, Escherichia fergusoniig+wgs, Escherichia marmotaeg+wgs, Shigella boydiig+wgs, Shigella dysenteriaeg+wgs, Shigella flexnerig+wgs, Shigella sonneig+wgs
Publications

Purewal AS, et al. 1991. FEMS Microbiol. Lett. 66(2):229-31 Nucleotide sequence of the ethidium efflux gene from Escherichia coli. (PMID 1936950)

Resistomes

Prevalence of Escherichia coli emrE among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Citrobacter werkmanii0%0%5.13%0%0%
Enterobacter roggenkampii0%0%0.36%0%0%
Escherichia albertii100%0%99.35%0%0%
Escherichia coli44.02%0.02%57.79%0%73.4%
Escherichia fergusonii8.2%0%10.87%0%0%
Escherichia marmotae100%0%97.92%0%0%
Shigella boydii6.67%0%10%0%0%
Shigella dysenteriae7.14%0%33.33%0%0%
Shigella flexneri78%0%95.81%0%0%
Shigella sonnei100%0%96.06%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 190


>gb|CAA77936.1|+|Escherichia coli emrE [Escherichia coli]
MNPYIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFWLLAQTLAYIPTGIAYAIWSGVGIVLISLLSWGFFGQRLDLPAIIG
MMLICAGVLIINLLSRSTPH


>gb|Z11877.1|+|486-818|Escherichia coli emrE [Escherichia coli]
ATGAACCCTTATATTTATCTTGGTGGTGCAATACTTGCAGAGGTCATTGGTACAACCTTAATGAAGTTTTCAGAAGGTTTTACACGGTTA
TGGCCATCTGTTGGTACAATTATTTGTTATTGTGCATCATTCTGGTTATTAGCTCAGACGCTGGCTTATATTCCTACAGGGATTGCTTAT
GCTATCTGGTCAGGAGTCGGTATTGTCCTGATTAGCTTACTGTCATGGGGATTTTTCGGCCAACGGCTGGACCTGCCAGCCATTATAGGC
ATGATGTTGATTTGTGCCGGTGTGTTGATTATTAATTTATTGTCACGAAGCACACCACATTAA

Curator Acknowledgements
Curator Description Most Recent Edit