Accession ARO:3000172
DefinitionA thiol transferase that leads to the resistance of fosfomycin. Contrasting FosA, FosB is dependent on the cofactor Magnesium (II) and uses either bacillithiol or L-cysteine to open up the epoxide ring of fosfomycin.
AMR Gene Familyfosfomycin thiol transferase
Drug Classfosfomycin
Resistance Mechanismantibiotic inactivation
Classification12 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic fosfomycin [Drug Class]
+ fosfomycin thiol transferase [AMR Gene Family]
Publications

Thompson MK, et al. 2014. Biochemistry 53(4): 755-765. Structure and Function of the Genomically Encoded Fosfomycin Resistance Enzyme, FosB, from Staphylococcus aureus. (PMID 24447055)

Thompson MK, et al. 2013. Biochemistry 52(41): 7350-7362. Structural and chemical aspects of resistance to the antibiotic fosfomycin conferred by FosB from Bacillus cereus. (PMID 24004181)

Resistomes

Prevalence of FosB among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Bacillus anthracis96.23%0%98.16%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 225


>gb|AAP08996.1|+|FosB [Bacillus cereus ATCC 14579]
MLRGINHICFSVSNLENSIMFYEKVLEGELLVKGRKLAYFNICGVWIALNEETHIPRNEVHQSYTHIAFSVEQEDFKCLIQRLEENDVHI
LQGRERDVRDCESIYFVDPDGHKFEFHSGTLQDRLNYYRDEKPHMTFY


>gb|AE016877.1|+|1972252-1972668|FosB [Bacillus cereus ATCC 14579]
TTGTTAAGGGGAATCAATCATATTTGTTTTTCGGTATCTAATTTAGAAAACTCTATTATGTTTTATGAAAAAGTATTAGAAGGAGAATTA
TTAGTTAAAGGAAGAAAATTGGCTTATTTTAACATATGTGGAGTATGGATAGCGCTTAATGAAGAGACGCATATTCCGAGAAATGAGGTT
CATCAATCTTATACGCACATTGCATTTTCTGTTGAACAAGAAGACTTTAAATGTCTAATACAGCGATTAGAAGAAAATGATGTTCATATT
TTACAAGGAAGAGAACGTGATGTAAGAGATTGCGAATCTATATACTTTGTTGATCCTGACGGTCATAAATTTGAGTTTCACTCAGGGACA
CTGCAAGACCGTTTAAATTATTATAGAGATGAGAAACCTCATATGACATTTTATTAG