MexG

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3000806
CARD Short NameMexG
DefinitionMexG is a membrane protein required for MexGHI-OpmD efflux activity.
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump
Drug Classdisinfecting agents and antiseptics, tetracycline antibiotic, fluoroquinolone antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Classification14 ontology terms | Show
Parent Term(s)3 ontology terms | Show
Resistomes with Perfect MatchesPseudomonas aeruginosag+wgs, Pseudomonas fluorescensg
Resistomes with Sequence VariantsPseudomonas aeruginosag+wgs, Pseudomonas fluorescensg
Publications

Schweizer HP. 2003. Genet Mol Res 2(1): 48-62. Efflux as a mechanism of resistance to antimicrobials in Pseudomonas aeruginosa and related bacteria: unanswered questions. (PMID 12917802)

Aendekerk S, et al. 2005. Microbiology 151(PT 4): 1113-1125. The MexGHI-OpmD multidrug efflux pump controls growth, antibiotic susceptibility and virulence in Pseudomonas aeruginosa via 4-quinolone-dependent cell-to-cell communication. (PMID 15817779)

Resistomes

Prevalence of MexG among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Pseudomonas aeruginosa98.31%0%94.87%0%0%
Pseudomonas fluorescens2.78%0%0%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 260


>gb|AAG07592.1|+|MexG [Pseudomonas aeruginosa PAO1]
MQRFIDNSLESNWLWLTARICLALMFVASGLAKLFDYQASLEEMRAAGLEPAWLFNIATAVTLLAGSALVLLDRKLWLGAGALAVFLLLT
ILIVHTFWSKTGVEAKLAMFFALEHIAVIGGLIATAIASAQRQRLRQDVSVAATYQKA


>gb|AE004091.2|+|4705956-4706402|MexG [Pseudomonas aeruginosa PAO1]
ATGCAGCGCTTCATCGATAACTCGCTCGAAAGCAACTGGCTCTGGCTGACCGCCCGGATCTGCCTGGCCCTGATGTTCGTCGCCTCGGGA
CTGGCGAAGCTGTTCGACTATCAGGCCAGCCTGGAGGAAATGCGCGCCGCCGGCCTGGAGCCGGCCTGGCTGTTCAACATCGCCACCGCC
GTGACCCTGCTGGCCGGCTCCGCGCTGGTCCTGCTGGACCGCAAGCTATGGCTCGGCGCCGGGGCGCTGGCGGTGTTCCTGCTGCTGACC
ATCCTCATCGTCCACACCTTCTGGAGCAAGACCGGCGTCGAAGCCAAGCTGGCGATGTTCTTCGCCCTCGAACACATCGCGGTGATCGGC
GGCCTGATCGCCACGGCCATCGCCAGCGCGCAACGCCAGCGGCTGCGCCAGGACGTCTCCGTGGCCGCCACCTACCAGAAGGCCTGA

Curator Acknowledgements
Curator Description Most Recent Edit