FosA3

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002872
CARD Short NameFosA3
DefinitionAn enzyme that confers resistance to fosfomycin in Escherichia coli by breaking the epoxide ring of the molecule. It depends on the cofactors Manganese (II) and Potassium and uses Glutathione (GSH) as the nucleophilic molecule.
AMR Gene Familyfosfomycin thiol transferase
Drug Classphosphonic acid antibiotic
Resistance Mechanismantibiotic inactivation
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONEscherichia coli (31), Klebsiella pneumoniae (9), Enterobacteriaceae (7), Salmonella (4), Enterobacter cloacae (2)
GAZChina (21), Guangdong Province (2), Brazil (2), Republic of China (2)
FOODONswine (7), chicken (6), Bos taurus (2)
ENVOhospital (2)
UBERON
Classification10 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic fosfomycin [Antibiotic]
+ fosfomycin thiol transferase [AMR Gene Family]
Resistomes with Perfect MatchesAcinetobacter baumanniig+wgs+gi, Aeromonas hydrophilap, Aeromonas veroniig, Avibacterium paragallinarumwgs, Citrobacter freundiig+p+wgs, Citrobacter portucalensisp, Citrobacter youngaewgs, Enterobacter asburiaewgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Escherichia albertiip+wgs, Escherichia colig+p+wgs+gi, Escherichia fergusoniip+wgs, Klebsiella aerogenesp, Klebsiella huaxiensisg+gi, Klebsiella michiganensisp+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Morganella morganiig+wgs, Proteus mirabilisg+wgs+gi, Proteus penneriwgs, Providencia rettgeriwgs, Pseudomonas monteiliip+wgs, Raoultella planticolap, Salmonella entericag+p+wgs+gi, Shigella flexnerip+wgs, Streptococcus suiswgs
Resistomes with Sequence VariantsAcinetobacter baumanniig+wgs+gi, Aeromonas hydrophilap, Aeromonas veroniig, Avibacterium paragallinarumwgs, Citrobacter freundiig+p+wgs, Citrobacter portucalensisp, Citrobacter youngaewgs, Cronobacter turicensiswgs, Enterobacter asburiaewgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Escherichia albertiip+wgs, Escherichia colig+p+wgs+gi, Escherichia fergusoniip+wgs, Klebsiella aerogenesp, Klebsiella huaxiensisg+gi, Klebsiella michiganensisp+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Morganella morganiig+wgs, Proteus mirabilisg+p+wgs+gi, Proteus penneriwgs, Providencia rettgeriwgs, Pseudomonas monteiliip+wgs, Raoultella planticolap, Salmonella entericag+p+wgs+gi, Shigella flexnerip+wgs, Streptococcus suiswgs
Publications

Alrowais H, et al. 2015. Emerging Infect. Dis. 21(11):2045-7 Fosfomycin Resistance in Escherichia coli, Pennsylvania, USA. (PMID 26488485)

Resistomes

Prevalence of FosA3 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii0.18%0%0.22%0.63%0%
Aeromonas hydrophila0%1.3%0%0%0%
Aeromonas veronii1.82%0%0%0%0%
Avibacterium paragallinarum0%0%5.88%0%0%
Citrobacter freundii0.82%1.23%2.13%0%0%
Citrobacter portucalensis0%1.47%0%0%0%
Citrobacter youngae0%0%6.25%0%0%
Cronobacter turicensis0%0%25%0%0%
Enterobacter asburiae0%0%1.58%0%0%
Enterobacter cloacae0%1.12%0.32%0%0%
Enterobacter hormaechei0%0.19%0.95%0%0%
Escherichia albertii0%1.13%2.58%0%0%
Escherichia coli0.48%0.94%4.16%0.26%0%
Escherichia fergusonii0%1.07%9.78%0%0%
Klebsiella aerogenes0%1.09%0%0%0%
Klebsiella huaxiensis100%0%0%50%0%
Klebsiella michiganensis0%1.14%0.8%0%0%
Klebsiella pneumoniae0.18%1.14%4.11%0%0%
Klebsiella quasipneumoniae0%0.64%2.37%0%0%
Morganella morganii3.85%0%1.84%0%0%
Proteus mirabilis14.68%1.25%11.39%3.7%0%
Proteus penneri0%0%12.5%0%0%
Providencia rettgeri0%0%0.64%0%0%
Pseudomonas monteilii0%14.29%2.38%0%0%
Raoultella planticola0%2.33%0%0%0%
Salmonella enterica0.95%2.19%1.5%0.99%0%
Shigella flexneri0%2.01%0.47%0%0%
Streptococcus suis0%0%0.1%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 200


>gb|AEG78825.1|+|FosA3 [Escherichia coli]
MLQGLNHLTLAVSDLASSLAFYQQLPGMRLHASWDSGAYLSCGALWLCLSLDEQRRKTPPQESDYTHYAFSVAEEEFAGVVALLAQAGAE
VWKDNRSEGASYYFLDPDGHKLELHVGNLAQRLAACRERPYKGMVFFD


>gb|JF411006.1|+|952-1368|FosA3 [Escherichia coli]
ATGCTGCAGGGATTGAATCATCTGACGCTGGCGGTCAGCGATCTGGCGTCAAGCCTGGCATTTTATCAGCAGTTACCTGGAATGCGCCTG
CACGCCAGCTGGGATAGCGGAGCCTATCTCTCCTGTGGGGCGCTGTGGCTGTGCTTGTCGCTGGATGAGCAGCGGCGTAAAACGCCCCCT
CAGGAAAGCGACTATACCCACTACGCCTTCAGCGTGGCGGAAGAAGAGTTTGCCGGGGTGGTGGCTCTGCTGGCGCAGGCGGGGGCTGAG
GTATGGAAAGATAACCGCAGTGAAGGGGCGTCTTACTATTTTCTCGACCCTGACGGCCATAAGCTGGAGCTGCATGTGGGGAATCTGGCG
CAGCGGCTGGCCGCCTGTCGCGAACGCCCCTACAAGGGGATGGTCTTTTTTGATTGA

Curator Acknowledgements
Curator Description Most Recent Edit