FosXCC

Accession ARO:3003208
CARD Short NameFosXCC
DefinitionfosXCC is a fosfomycin resistance gene that modifies MurA isolated from Campylobacter species. It is highly resistant to fosfomycin.
AMR Gene Familyfosfomycin thiol transferase
Drug Classphosphonic acid antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesEnterococcus faeciumwgs
Resistomes with Sequence VariantsBrucella abortusg+wgs, Brucella canisg+wgs, Brucella melitensisg+wgs, Brucella suisg+wgs, Campylobacter coliwgs, Clostridium botulinumg+wgs, Clostridium sporogenesg+wgs, Enterococcus faecaliswgs, Enterococcus faeciumg+wgs, Klebsiella pneumoniaewgs, Megasphaera stantoniig+wgs
Classification10 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ fosfomycin thiol transferase [AMR Gene Family]
+ confers_resistance_to_antibiotic fosfomycin [Antibiotic]
Publications

Wang Y, et al. 2015. J Antimicrob Chemother 70(4): 1261-1263. Identification of a novel fosXCC gene conferring fosfomycin resistance in Campylobacter. (PMID 25433007)

Resistomes

Prevalence of FosXCC among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 413 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Brucella abortus78.57%0%71%0%
Brucella canis50%0%94.74%0%
Brucella melitensis50.24%0%71.84%0%
Brucella suis50%0%60.42%0%
Campylobacter coli0%0%0.18%0%
Clostridium botulinum59.7%0%33.7%0%
Clostridium sporogenes8.33%0%13.68%0%
Enterococcus faecalis0%0%0.12%0%
Enterococcus faecium0.64%0%2.95%0%
Klebsiella pneumoniae0%0%0.01%0%
Megasphaera stantonii100%0%100%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 150


>gb|AIF29598.1|+|FosXCC [Campylobacter coli]
MGVGKLIYGISHITFIVKDLDKATKFFKEIFEAKEIYSSEDKKFSISKEKFFLINDLWIAVMEGEEMEKSYNHIAFKIDESDYEMYLKRI
ENLGLEIKAGRKRVIGEGNSIYFYDYDNHLFELHTGTLETRLLRYQKEPTD


>gb|KC876749.1|+|4709-5134|FosXCC [Campylobacter coli]
TTGGGGGTGGGAAAGTTGATATATGGAATTAGTCATATTACTTTTATTGTCAAAGACCTAGATAAAGCCACAAAATTTTTTAAAGAAATT
TTTGAAGCCAAAGAAATTTATTCAAGCGAAGACAAAAAGTTTTCTATATCCAAAGAAAAATTTTTCTTGATAAACGACCTTTGGATTGCA
GTTATGGAAGGAGAGGAAATGGAAAAAAGCTATAATCATATAGCATTTAAAATAGATGAATCGGATTATGAAATGTACCTTAAGAGAATA
GAAAACCTTGGTTTAGAGATAAAAGCTGGGAGAAAAAGGGTTATAGGAGAGGGGAATTCAATATATTTTTATGACTATGATAATCATCTT
TTCGAACTCCACACTGGAACATTGGAAACAAGACTTCTTCGCTACCAAAAAGAACCAACAGATTAA