Staphylococcus aureus GlpT with mutation conferring resistance to fosfomycin

Accession ARO:3003901
DefinitionMutations to the active importer GlpT, which is involved with the uptake of many phosphorylated sugars, confer resistance to fosfomycin by reducing import of the drug into the bacteria.
AMR Gene FamilyGlpT
Drug Classfosfomycin
Resistance Mechanismantibiotic target alteration
Classification9 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic fosfomycin [Drug Class]
+ antibiotic resistant gene variant or mutant
+ GlpT [AMR Gene Family]
Publications

Fu Z, et al. 2015. Front Microbiol 6:1544 Prevalence of Fosfomycin Resistance and Mutations in murA, glpT, and uhpT in Methicillin-Resistant Staphylococcus aureus Strains Isolated from Blood and Cerebrospinal Fluid Samples. (PMID 26793179)

Resistomes

Prevalence of Staphylococcus aureus GlpT with mutation conferring resistance to fosfomycin among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein variant model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Staphylococcus aureus29.86%0%20.7%
Show Perfect Only


Detection Models

Model Type: protein variant model

Model Definition: The protein variant model is an AMR detection model. Protein variant models are similar to protein homolog models - they detect the presence of a protein sequence based on its similarity to a curated reference sequence, but secondarily search submitted query sequences for curated sets of mutations shown clinically to confer resistance relative to wild-type. This model includes a protein reference sequence, a curated BLASTP cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of: single resistance variants, insertions, deletions, co-dependent resistance variants, nonsense SNPs, and/or frameshift mutations. Protein variant model matches to reference sequences are categorized on two criteria: strict and loose. A strict match has a BLASTP bitscore above the curated BLASTP cutoff value and contains at least one detected mutation from amongst the mapped resistance variants; a loose match has a BLASTP bitscore below the curated BLASTP cutoff value but still contains at least one detected mutation from amongst the mapped resistance variants. Regardless of BLASTP bitscore, if a sequence does not contain one of the mapped resistance variants, it is not considered a match and not detected by the protein variant model.

Legend:

  • discovered in clinical, agricultural, or environmental isolates
  • discovered via laboratory selection experiments


Bit-score Cut-off (blastP): 800

PMID: 26793179F3I L27F A100V W137R V213I G352D W355STOP -nt225:TGGATTTA -nt248:G +nt392:T

>gb|CAG39357|-|Staphylococcus aureus GlpT with mutation conferring resistance to fosfomycin [Staphylococcus aureus subsp. aureus MRSA252]
MNFLKPAKHIKPLPENQIDDTYKRLRLQVFLGIFIGYAGYYLLRKNFSLAMPALQEQGFT
KAELGFALSAVSIAYGFSKFFMGTVSDRSNARIFLVLGLVLTAIVNLLMGFVPFFTSGIG
IMFVLLFLNGWFQGMGWPPSGRVLVHWFSVSERGSKTALWNVAHNVGGGIMAPIAAWGIT
TTAFINFGYLKGFEGVFIYPALLALIIAAISYILIRDTPQSQGLPPIEIYKNDFATSDKK
TLETELTTKEILFKYVLNNKWVWAIAFANIFVYFVRYGVLDWAPVYLSEEKHFDLKASGW
AYFLYEWAGIPGTLLCGYISDKLFKGRRGPAGFFFMLGVTVFVLIYWLNPPGNAWLDNVS
LIAIGFLIYGPVMLIGLQALDYVPKKAAGTAAGLTGLFGYLFGAVMANIVLGAVVDKFGW
DVGFILLTAISVFAMLSFILTWNKVGQETVHH



>gb|BX571856.1|-|378556-379914|Staphylococcus aureus GlpT with mutation conferring resistance to fosfomycin [Staphylococcus aureus subsp. aureus MRSA252]
ATGAATTTTCTTAAACCTGCAAAGCATATTAAGCCTTTGCCAGAAAATCAGATAGATGATACCTATAAACGATTACGTCTCCAAGTATTT
CTTGGTATTTTCATCGGTTACGCTGGGTACTATTTATTACGTAAAAACTTTTCATTAGCGATGCCGGCATTGCAAGAGCAAGGTTTTACA
AAAGCAGAACTAGGTTTTGCGCTTTCTGCTGTTTCCATCGCATATGGATTTAGTAAGTTCTTTATGGGTACTGTAAGTGATCGGAGCAAT
GCACGGATATTCTTAGTTCTTGGATTAGTACTCACTGCTATCGTCAATTTGTTAATGGGATTTGTACCGTTCTTTACATCAGGTATCGGT
ATTATGTTTGTCCTATTATTCTTAAATGGATGGTTTCAAGGTATGGGCTGGCCACCTTCAGGCCGTGTTCTCGTTCACTGGTTTAGTGTA
AGTGAACGCGGAAGTAAGACTGCTCTTTGGAACGTTGCGCATAATGTTGGTGGAGGTATTATGGCACCTATTGCTGCTTGGGGTATTACA
ACAACAGCATTTATCAACTTTGGTTATTTAAAAGGTTTTGAAGGTGTATTCATTTACCCTGCACTCTTAGCACTTATCATTGCCGCAATT
TCATATATATTGATTAGAGACACACCTCAATCTCAAGGTTTACCTCCAATCGAAATTTATAAAAATGACTTTGCTACAAGCGATAAGAAA
ACATTAGAAACAGAATTAACTACAAAAGAAATTTTATTTAAATATGTACTGAACAATAAATGGGTATGGGCAATTGCCTTTGCAAATATA
TTTGTTTATTTCGTGCGTTATGGTGTACTTGATTGGGCGCCAGTCTACTTAAGTGAAGAAAAACATTTCGACTTAAAAGCATCAGGTTGG
GCATACTTCTTATACGAATGGGCTGGAATTCCTGGTACATTATTATGTGGTTACATTTCTGATAAATTATTCAAAGGTCGCCGTGGACCT
GCTGGTTTCTTCTTTATGTTAGGTGTCACAGTATTTGTATTAATTTATTGGTTAAATCCTCCAGGCAATGCTTGGTTAGACAATGTCTCA
TTAATTGCCATTGGTTTCTTAATATATGGACCAGTTATGTTAATTGGTTTACAAGCATTAGATTATGTACCTAAAAAAGCAGCTGGCACA
GCAGCTGGATTAACTGGATTATTTGGTTATCTGTTTGGTGCTGTAATGGCCAACATCGTCTTAGGTGCTGTAGTTGATAAATTCGGATGG
GATGTCGGTTTTATTTTATTAACAGCAATCAGTGTGTTTGCAATGTTGAGCTTTATCCTCACTTGGAATAAAGTAGGACAAGAAACTGTT
CATCATTAA