FosA6

Accession ARO:3004111
DefinitionfosA6 is a plasmid-encoded enzyme that confers resistance to fosfomycin in Escherichia coli by breaking the epoxide ring of the molecule.
AMR Gene Familyfosfomycin thiol transferase
Drug Classfosfomycin
Resistance Mechanismantibiotic inactivation
Classification12 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic fosfomycin [Drug Class]
+ fosfomycin thiol transferase [AMR Gene Family]
Publications

Guo Q, et al. 2016. J. Antimicrob. Chemother. 71(9):2460-5 Glutathione-S-transferase FosA6 of Klebsiella pneumoniae origin conferring fosfomycin resistance in ESBL-producing Escherichia coli. (PMID 27261267)

Resistomes

Prevalence of FosA6 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Enterobacter cloacae0%0%0.23%
Enterococcus faecium0%0%0.07%
Escherichia coli0%0%0.03%
Klebsiella oxytoca0%0%6.54%
Klebsiella pneumoniae0%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 280


>gb|AMQ12811.1|+|FosA6 [Escherichia coli]
MLSGLNHLTLAVSQLAPSVAFYQQLLGMTLHARWDSGAYLSCGDLWLCLSLDPQRRVTPPEESDYTHYAFSISEADFASFAARLEAAGVA
IWKLNRSEGASHYFLDPDGHKLELHVGSLAQRLAACREQQYKGMVFFDQ


>gb|KU254579.1|+|59422-59841|FosA6 [Escherichia coli]
ATGCTGAGTGGACTGAATCACCTGACCCTGGCAGTCAGCCAGCTGGCGCCGAGCGTGGCGTTTTATCAGCAGCTGCTGGGCATGACGCTG
CATGCCCGCTGGGACAGCGGGGCTTATCTCTCCTGCGGCGATTTGTGGCTGTGCCTGTCGCTGGATCCGCAGCGGCGCGTTACTCCGCCG
GAAGAGAGCGACTACACCCATTATGCGTTTAGTATTAGCGAAGCCGATTTTGCTAGCTTCGCCGCCCGCCTTGAGGCTGCCGGCGTGGCG
ATCTGGAAGCTGAACCGTAGCGAAGGTGCCTCGCACTATTTCCTCGATCCCGATGGCCATAAGCTGGAGCTGCACGTCGGCAGTCTCGCC
CAGCGTCTGGCCGCCTGCCGCGAACAGCAGTATAAGGGGATGGTGTTTTTTGATCAGTGA