FosA7

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3004113
CARD Short NameFosA7
DefinitionFosA7 is an enzyme that confers resistance to fosfomycin in Escherichia coli by breaking the epoxide ring of the molecule.
AMR Gene Familyfosfomycin thiol transferase
Drug Classphosphonic acid antibiotic
Resistance Mechanismantibiotic inactivation
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONSalmonella (4)
GAZ
FOODON
ENVO
UBERON
Classification10 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic fosfomycin [Antibiotic]
+ fosfomycin thiol transferase [AMR Gene Family]
Resistomes with Perfect MatchesSalmonella entericag+wgs
Resistomes with Sequence VariantsCitrobacter freundiig+wgs, Citrobacter koserig+wgs, Citrobacter portucalensiswgs, Enterobacter cloacaewgs, Enterobacter hormaecheiwgs, Escherichia colig+wgs, Klebsiella aerogeneswgs, Klebsiella michiganensiswgs, Klebsiella oxytocawgs, Klebsiella pneumoniaeg+wgs, Klebsiella quasipneumoniaewgs, Salmonella entericag+wgs, Serratia marcescenswgs
Publications

Rehman MA, et al. 2017. Antimicrob. Agents Chemother. : First Detection of a Fosfomycin Resistance Gene fosA7 in Salmonella enterica serovar Heidelberg Isolated from Broiler Chickens. (PMID 28533247)

Resistomes

Prevalence of FosA7 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Citrobacter freundii0.82%0%3.09%0%0%
Citrobacter koseri18.75%0%36.94%0%0%
Citrobacter portucalensis0%0%2.7%0%0%
Enterobacter cloacae0%0%0.96%0%0%
Enterobacter hormaechei0%0%0.13%0%0%
Escherichia coli0.02%0%0.01%0%0%
Klebsiella aerogenes0%0%1.41%0%0%
Klebsiella michiganensis0%0%1.06%0%0%
Klebsiella oxytoca0%0%1.26%0%0%
Klebsiella pneumoniae0.06%0%0.09%0%0%
Klebsiella quasipneumoniae0%0%0.26%0%0%
Salmonella enterica5.43%0%8.38%0%0%
Serratia marcescens0%0%0.66%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 250

Type of Antibiotic Resistance: Intrinsic or chromosomally-encoded


>gb|KKE03230.1|+|FosA7 [Salmonella enterica subsp. enterica serovar Heidelberg]
MLQSLNHLTLAVSNLQTSLTFWRDLLGLQLHAEWDTGAYLTCGDLWVCLSYDVSCNYVAPQECDYTHYAFSIAPEDFEPFSYKLKQAGVT
VWKDNKSEGQSFYFLDPDGHKLELHVGDLASRLAQCREKPYSGMRFGPGK


>gb|LAPJ01000014.1|+|36823-37245|FosA7 [Salmonella enterica subsp. enterica serovar Heidelberg]
ATGCTTCAATCTCTGAACCACTTAACGCTTGCTGTCAGTAATTTGCAAACTAGCCTGACCTTCTGGCGCGATTTGCTGGGGTTGCAGCTA
CATGCTGAGTGGGATACTGGCGCTTACCTTACCTGTGGCGACCTTTGGGTCTGTCTTTCTTACGACGTATCCTGTAACTACGTGGCCCCG
CAGGAATGTGACTATACCCACTACGCATTCAGCATCGCGCCAGAAGATTTTGAACCGTTCTCGTATAAGCTGAAACAGGCGGGAGTGACG
GTCTGGAAAGACAATAAAAGCGAAGGGCAATCTTTCTATTTTCTTGACCCCGATGGCCACAAGCTGGAACTGCATGTGGGAGATTTAGCA
TCTCGACTGGCGCAGTGCCGGGAGAAGCCTTACTCTGGAATGCGTTTCGGGCCTGGAAAATAA

Curator Acknowledgements
Curator Description Most Recent Edit