FosB4

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3004671
CARD Short NameFosB4
DefinitionFosfomycin resistance gene. Shares a high homology with FosB1 and FosB3.
AMR Gene Familyfosfomycin thiol transferase
Drug Classphosphonic acid antibiotic
Resistance Mechanismantibiotic inactivation
Classification10 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic fosfomycin [Antibiotic]
+ fosfomycin thiol transferase [AMR Gene Family]
Resistomes with Perfect MatchesKlebsiella pneumoniaewgs, Staphylococcus aureuswgs, Staphylococcus epidermidisp, Staphylococcus haemolyticuswgs
Resistomes with Sequence VariantsKlebsiella pneumoniaewgs, Staphylococcus aureusp+wgs, Staphylococcus capitiswgs, Staphylococcus epidermidisp+wgs, Staphylococcus haemolyticuswgs, Staphylococcus hominiswgs
Publications

Fu Z, et al. 2016. PLoS ONE 11(5):e0154829 Characterization of Fosfomycin Resistance Gene, fosB, in Methicillin-Resistant Staphylococcus aureus Isolates. (PMID 27144405)

Resistomes

Prevalence of FosB4 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Klebsiella pneumoniae0%0%0.01%0%0%
Staphylococcus aureus0%0.04%0.24%0%0%
Staphylococcus capitis0%0%1.9%0%0%
Staphylococcus epidermidis0%0.29%0.5%0%0%
Staphylococcus haemolyticus0%0%4.62%0%0%
Staphylococcus hominis0%0%3.9%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 270


>gb|ALM24139.1|+|FosB4 [Staphylococcus aureus]
MIKGINHITYSVSNIAKSIEFYRDILGADILVESETSAYFNLGGIWLALNEEKNIPRSEIKYSYTHIAFTISDNDFEDWYIWLKENEVNI
LEGRDRDIRDKKSIYFTDLDGHKLELHTGSLEDRLSYYKEAKPHMNFYI


>gb|KR870311.1|+|99-518|FosB4 [Staphylococcus aureus]
ATGATTAAAGGAATAAATCATATTACTTATTCGGTTTCTAATATAGCTAAATCAATTGAATTTTACAGAGATATTTTAGGGGCTGACATT
TTAGTTGAAAGTGAGACCTCGGCCTATTTTAATTTAGGTGGTATATGGTTAGCTTTGAACGAAGAAAAAAATATTCCTAGAAGCGAAATT
AAATATTCGTATACTCATATAGCATTTACAATTTCAGATAACGATTTTGAAGATTGGTATATCTGGTTGAAAGAAAATGAAGTAAATATT
CTTGAAGGTAGAGATAGAGATATTAGAGATAAAAAATCAATATATTTCACTGATTTAGATGGCCATAAATTAGAATTGCATACAGGAAGT
TTAGAAGATAGATTGAGTTATTATAAAGAGGCTAAACCTCATATGAATTTTTATATTTAA

Curator Acknowledgements
Curator Description Most Recent Edit