FosA7.5

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3005162
CARD Short NameFosA7.5
DefinitionFosA7.5 is a variant of the FosA7 gene. This gene is unique from FosA7 in that it is found in Escherichia coli as opposed to Salmonella enterica. It confers resistance to fosfomycin.
AMR Gene Familyfosfomycin thiol transferase
Drug Classphosphonic acid antibiotic
Resistance Mechanismantibiotic inactivation
Classification10 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic fosfomycin [Antibiotic]
+ fosfomycin thiol transferase [AMR Gene Family]
Resistomes with Perfect MatchesCitrobacter koserig+wgs, Enterobacter hormaecheiwgs, Escherichia colig+p+wgs, Shigella flexneriwgs, Shigella sonneiwgs
Resistomes with Sequence VariantsCitrobacter koserig+wgs, Enterobacter hormaecheiwgs, Escherichia colig+p+wgs, Klebsiella aerogeneswgs, Salmonella entericawgs, Shigella flexneriwgs, Shigella sonneiwgs
Publications

Milner KA, et al. 2020. Antimicrob Agents Chemother : Identification and characterization of a novel FosA7 member from fosfomycin resistant Escherichia coli clinical isolates from Canadian hospitals. (PMID 33077665)

Resistomes

Prevalence of FosA7.5 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Citrobacter koseri6.25%0%5.41%0%0%
Enterobacter hormaechei0%0%0.09%0%0%
Escherichia coli0.57%0.01%0.83%0%0.22%
Klebsiella aerogenes0%0%0.28%0%0%
Salmonella enterica0%0%0.01%0%0%
Shigella flexneri0%0%0.31%0%0%
Shigella sonnei0%0%0.07%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 280


>gb|ANQ03635.1|+|FosA7.5 [Escherichia coli]
MLQSLNHLTLAVSNLQSSLTFWRDLLGLQLHAEWGTGAYLTCGDLWLCLSYDVSRSYVAPQKSDYTHYAFSIAPEDFEPFSYKLKQSGVT
VWKDNKSEGQSFYFLDPDGHKLELHVGDLASRLAQCRERPYSGMRFGPGK


>gb|CP015912.1|+|3480173-3480595|FosA7.5 [Escherichia coli]
ATGCTTCAATCTCTGAACCACTTAACGCTTGCTGTCAGTAATTTGCAAAGTAGCCTGACATTCTGGCGCGATTTGCTGGGGTTGCAGTTA
CATGCTGAGTGGGGTACAGGTGCTTACCTTACCTGTGGTGACCTTTGGCTCTGTCTTTCTTATGACGTATCCCGTAGCTACGTGGCCCCA
CAGAAAAGTGACTATACCCATTACGCATTCAGCATTGCGCCAGAAGATTTTGAGCCGTTCTCATATAAGCTGAAACAGTCGGGAGTGACG
GTCTGGAAAGACAATAAAAGCGAAGGGCAATCTTTCTATTTTCTTGACCCGGATGGCCACAAGCTGGAGCTGCATGTGGGAGATTTAGCA
TCTCGACTGGCGCAGTGCCGGGAGAGGCCTTACTCTGGAATGCGTTTTGGTCCTGGTAAATAA

Curator Acknowledgements
Curator Description Most Recent Edit