FosA8

Download Sequences
Accession ARO:3007371
CARD Short NameFosA8
DefinitionFosA8 is a plasmid-located fosfomycin resistance gene.
AMR Gene Familyfosfomycin thiol transferase
Drug Classphosphonic acid antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesEnterobacter hormaecheiwgs, Escherichia colip+wgs, Klebsiella pneumoniaep, Leclercia adecarboxylatawgs
Resistomes with Sequence VariantsAcinetobacter baumanniig+wgs, Acinetobacter calcoaceticuswgs, Acinetobacter johnsoniiwgs, Acinetobacter juniiwgs, Acinetobacter nosocomialisg+wgs, Acinetobacter pittiig+wgs, Aeromonas caviaeg+wgs, Aeromonas enteropelogenesg+wgs, Aeromonas veroniig+wgs, Alcaligenes faecalisg+wgs, Bordetella trematumg+wgs, Citrobacter amalonaticusg+wgs, Citrobacter freundiiwgs, Citrobacter koseriwgs, Citrobacter portucalensiswgs, Citrobacter werkmaniiwgs, Comamonas testosteronig+wgs, Cronobacter condimentig+wgs, Cronobacter dublinensisg+wgs, Cronobacter malonaticusg+wgs, Cronobacter sakazakiig+wgs, Enterobacter cloacaewgs, Enterobacter hormaecheiwgs, Enterobacter kobeiwgs, Escherichia albertiig+wgs, Escherichia colig+p+wgs, Inquilinus limosuswgs, Klebsiella aerogeneswgs, Klebsiella oxytocawgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaewgs, Leclercia adecarboxylatag+wgs, Legionella pneumophilag+wgs, Morganella morganiig+wgs, Orientia tsutsugamushiwgs, Proteus columbaewgs, Proteus mirabilisg+wgs, Proteus vulgarisg+wgs, Providencia alcalifacienswgs, Providencia rettgerig+wgs, Providencia stuartiig+wgs, Pseudomonas aeruginosawgs, Pseudomonas brassicacearumg+wgs, Pseudomonas chlororaphisg+wgs, Pseudomonas fluorescensg+wgs, Pseudomonas koreensiswgs, Pseudomonas putidag+wgs, Pseudomonas synxanthag+wgs, Pseudomonas syringaewgs, Ralstonia pickettiiwgs, Rhodanobacter glycinisg+wgs, Salmonella entericag+wgs, Serratia liquefaciensg+wgs, Serratia marcescensg+p+wgs, Serratia odoriferag+wgs, Serratia rubidaeag+wgs, Vibrio owensiig+wgs, Vibrio parahaemolyticuswgs
Classification10 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic fosfomycin [Antibiotic]
+ fosfomycin thiol transferase [AMR Gene Family]
Publications

Poirel L, et al. 2019. Antimicrob Agents Chemother 63(11): Identification of FosA8, a Plasmid-Encoded Fosfomycin Resistance Determinant from Escherichia coli, and Its Origin in Leclercia adecarboxylata. (PMID 31481445)
Resistomes

Prevalence of FosA8 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii2.12%0%1.57%0%0%
Acinetobacter calcoaceticus0%0%4.35%0%0%
Acinetobacter johnsonii0%0%1.82%0%0%
Acinetobacter junii0%0%1.49%0%0%
Acinetobacter nosocomialis9.09%0%3.45%0%0%
Acinetobacter pittii13.51%0%7.67%0%0%
Aeromonas caviae4.55%0%2.15%0%0%
Aeromonas enteropelogenes100%0%62.5%0%0%
Aeromonas veronii5.45%0%5.62%0%0%
Alcaligenes faecalis5%0%2.94%0%0%
Bordetella trematum100%0%100%0%0%
Citrobacter amalonaticus18.18%0%10.91%0%0%
Citrobacter freundii0%0%0.58%0%0%
Citrobacter koseri0%0%0.9%0%0%
Citrobacter portucalensis0%0%2.7%0%0%
Citrobacter werkmanii0%0%5.13%0%0%
Comamonas testosteroni100%0%92.86%0%0%
Cronobacter condimenti100%0%100%0%0%
Cronobacter dublinensis100%0%92.31%0%0%
Cronobacter malonaticus100%0%89.09%0%0%
Cronobacter sakazakii100%0%97.09%0%0%
Enterobacter cloacae0%0%2.24%0%0%
Enterobacter hormaechei0%0%0.3%0%0%
Enterobacter kobei0%0%0.44%0%0%
Escherichia albertii4.29%0%1.94%0%0%
Escherichia coli0.02%0.04%0.04%0%0%
Inquilinus limosus0%0%25%0%0%
Klebsiella aerogenes0%0%1.13%0%0%
Klebsiella oxytoca0%0%0.42%0%0%
Klebsiella pneumoniae0.3%0.02%0.13%0%0%
Klebsiella quasipneumoniae0%0%0.13%0%0%
Leclercia adecarboxylata100%0%100%0%0%
Legionella pneumophila23.01%0%56.58%0%0%
Morganella morganii100%0%100%0%0%
Orientia tsutsugamushi0%0%25%0%0%
Proteus columbae0%0%50%0%0%
Proteus mirabilis11.93%0%18.15%0%0%
Proteus vulgaris27.27%0%16.67%0%0%
Providencia alcalifaciens0%0%3.45%0%0%
Providencia rettgeri97.06%0%98.09%0%0%
Providencia stuartii37.5%0%36.36%0%0%
Pseudomonas aeruginosa0%0%0.47%0%0%
Pseudomonas brassicacearum100%0%72%0%0%
Pseudomonas chlororaphis98.77%0%83.87%0%0%
Pseudomonas fluorescens50%0%51.74%0%0%
Pseudomonas koreensis0%0%13.04%0%0%
Pseudomonas putida1.41%0%2.67%0%0%
Pseudomonas synxantha100%0%100%0%0%
Pseudomonas syringae0%0%1.02%0%0%
Ralstonia pickettii0%0%1.27%0%0%
Rhodanobacter glycinis100%0%33.33%0%0%
Salmonella enterica1.26%0%1.26%0%0%
Serratia liquefaciens100%0%100%0%0%
Serratia marcescens98.48%1.29%97.64%0%0%
Serratia odorifera100%0%100%0%0%
Serratia rubidaea87.5%0%81.82%0%0%
Vibrio owensii50%0%78.95%0%0%
Vibrio parahaemolyticus0%0%0.41%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 100


>gb|QEI22965.1|+|FosA8 [Escherichia coli]
MLNALNHLTLAVSNLPASITFWRDLLGLRLHAEWHTGAYLTCGDLWLCLSYDETRTFIPPQNSDYTHYAFSVEPEHFDAVAQKLKDAGVT
VWKENKSEGASFYFLDPDGHKLELHVGDLAARLAACREKPYAGMVFTSDEA


>gb|MN150127.1|+|1-426|FosA8 [Escherichia coli]
ATGCTTAACGCCCTTAACCATCTGACCCTTGCTGTCAGCAACTTGCCTGCCAGCATCACTTTCTGGCGCGATCTTCTTGGCCTGCGCCTG
CACGCCGAATGGCACACCGGAGCTTACCTTACCTGTGGCGATCTCTGGCTCTGCCTGTCTTATGACGAGACGCGGACATTCATCCCACCA
CAGAACAGCGATTACACCCACTACGCCTTTTCTGTTGAACCGGAACACTTTGACGCCGTCGCGCAAAAGCTCAAAGACGCTGGCGTAACG
GTCTGGAAAGAGAACAAAAGCGAAGGGGCGTCGTTCTATTTTCTCGACCCGGACGGGCACAAACTGGAACTGCATGTGGGCGATCTGGCC
GCGCGTCTGGCGGCGTGTCGGGAGAAGCCTTACGCGGGAATGGTTTTTACGTCAGATGAAGCGTAA

Curator Acknowledgements
Curator Description Most Recent Edit