Accession ARO:3000377
DefinitionMexA is the membrane fusion protein of the MexAB-OprM multidrug efflux complex.
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump
Drug Classpeptide antibiotic, sulfonamide antibiotic, diaminopyrimidine antibiotic, penam, carbapenem, monobactam, fluoroquinolone antibiotic, phenicol antibiotic, cephalosporin, aminocoumarin antibiotic, tetracycline antibiotic, macrolide antibiotic, penem, cephamycin
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
ResistomesPseudomonas fluorescensg
Classification52 ontology terms | Show
+ process or component of antibiotic biology or chemistry
+ antibiotic molecule
+ peptide antibiotic [Drug Class]
+ beta-lactam antibiotic
+ mechanism of antibiotic resistance
+ resistance-modifying agents
+ lipopeptide antibiotic
+ antibiotic efflux [Resistance Mechanism]
+ cephem
+ sulfonamide antibiotic [Drug Class]
+ polymyxin antibiotic
+ diaminopyrimidine antibiotic [Drug Class]
+ determinant of antibiotic resistance
+ penam [Drug Class]
+ beta-lactamase inhibitor
+ carbapenem [Drug Class]
+ monobactam [Drug Class]
+ clavulanic acid [Adjuvant]
+ fluoroquinolone antibiotic [Drug Class]
+ amoxicillin [Antibiotic]
+ colistin
+ phenicol antibiotic [Drug Class]
+ cephalosporin [Drug Class]
+ aminocoumarin antibiotic [Drug Class]
+ tetracycline antibiotic [Drug Class]
+ efflux pump complex or subunit conferring antibiotic resistance [Efflux Component]
+ sulfamethoxazole [Antibiotic]
+ macrolide antibiotic [Drug Class]
+ antibiotic mixture
+ trimethoprim [Antibiotic]
+ ciprofloxacin [Antibiotic]
+ colistin B [Antibiotic]
+ penem [Drug Class]
+ panipenem [Antibiotic]
+ resistance-nodulation-cell division (RND) antibiotic efflux pump [AMR Gene Family]
+ ampicillin [Antibiotic]
+ ceftriaxone [Antibiotic]
+ meropenem [Antibiotic]
+ colistin A [Antibiotic]
+ chloramphenicol [Antibiotic]
+ ceftazidime [Antibiotic]
+ aztreonam [Antibiotic]
+ erythromycin [Antibiotic]
+ amoxicillin-clavulanic acid [Antibiotic]
+ trimethoprim-sulfamethoxazole [Antibiotic]
+ tetracycline [Antibiotic]
+ novobiocin [Antibiotic]
+ azithromycin [Antibiotic]
+ cephamycin [Drug Class]
+ MexAB-OprM
+ ticarcillin [Antibiotic]
+ nalidixic acid [Antibiotic]
Parent Term(s)7 ontology terms | Show
Publications

Akama H, et al. 2004. J Biol Chem 279(25): 25939-25942. Crystal structure of the membrane fusion protein, MexA, of the multidrug transporter in Pseudomonas aeruginosa. (PMID 15117957)

Resistomes

Prevalence of MexA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Enterobacter cloacae0%0%0%
Klebsiella pneumoniae0%0%0%
Proteus mirabilis0%0%0%
Pseudomonas aeruginosa0%0%0%
Pseudomonas fluorescens3.7%0%0%
Staphylococcus aureus0%0%0.01%
Show Perfect Only

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Enterobacter cloacae0%0%0%
Klebsiella pneumoniae0%0%0%
Proteus mirabilis0%0%0%
Pseudomonas aeruginosa0%0%0%
Pseudomonas fluorescens3.7%0%0%
Staphylococcus aureus0%0%0.01%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 650


>gb|NP_249116.1|+|MexA [Pseudomonas aeruginosa PAO1]
MQRTPAMRVLVPALLVAISALSGCGKSEAPPPAQTPEVGIVTLEAQTVTLNTELPGRTNAFRIAEVRPQVNGIILKRLFKEGSDVKAGQQ
LYQIDPATYEADYQSAQANLASTQEQAQRYKLLVADQAVSKQQYADANAAYLQSKAAVEQARINLRYTKVLSPISGRIGRSAVTEGALVT
NGQANAMATVQQLDPIYVDVTQPSTALLRLRRELASGQLERAGDNAAKVSLKLEDGSQYPLEGRLEFSEVSVDEGTGSVTIRAVFPNPNN
ELLPGMFVHAQLQEGVKQKAILAPQQGVTRDLKGQATALVVNAQNKVELRVIKADRVIGDKWLVTEGLNAGDKIITEGLQFVQPGVEVKT
VPAKNVASAQKADAAPAKTDSKG


>gb|NC_002516|+|472024-473175|MexA [Pseudomonas aeruginosa PAO1]
ATGCAACGAACGCCAGCCATGCGTGTACTGGTTCCGGCCCTGCTGGTCGCGATTTCGGCCCTTTCCGGGTGCGGAAAAAGCGAGGCGCCG
CCGCCGGCGCAAACGCCGGAGGTCGGGATCGTGACCCTGGAAGCGCAGACGGTGACCCTGAATACCGAGCTGCCGGGCCGGACCAATGCG
TTCCGCATCGCCGAGGTGCGTCCCCAGGTGAACGGCATCATCCTCAAGCGCCTGTTCAAGGAAGGCAGCGACGTCAAGGCCGGGCAGCAG
CTCTACCAGATCGACCCCGCCACCTACGAGGCCGACTACCAGAGCGCCCAGGCCAACCTGGCTTCGACCCAGGAACAGGCCCAGCGCTAC
AAGCTGCTGGTCGCCGACCAGGCCGTGAGCAAGCAGCAGTACGCCGACGCCAATGCCGCCTACCTGCAGTCCAAGGCGGCGGTGGAGCAG
GCGCGGATCAACCTGCGCTACACCAAGGTGCTGTCGCCGATCTCCGGCCGCATCGGCCGTTCCGCGGTGACCGAAGGCGCCCTGGTGACC
AACGGCCAGGCCAACGCGATGGCCACCGTGCAACAGCTCGACCCGATCTACGTCGACGTCACCCAGCCGTCCACCGCCCTGCTGCGCCTG
CGCCGCGAACTGGCCAGCGGCCAGTTGGAGCGCGCCGGCGACAACGCGGCGAAGGTCTCCCTGAAGCTGGAGGACGGTAGCCAATACCCG
CTGGAAGGTCGCCTCGAATTCTCCGAGGTTTCCGTCGACGAAGGCACCGGCTCGGTCACCATCCGCGCCGTGTTCCCCAACCCGAACAAC
GAGCTGCTGCCCGGCATGTTCGTTCACGCGCAGTTGCAGGAAGGCGTCAAGCAGAAGGCCATCCTCGCTCCGCAGCAAGGCGTGACCCGC
GACCTCAAGGGCCAGGCTACCGCGCTGGTGGTGAACGCGCAGAACAAGGTCGAGCTGCGGGTGATCAAGGCCGACCGGGTGATCGGCGAC
AAGTGGCTGGTTACCGAAGGCCTGAACGCCGGCGACAAGATCATTACCGAAGGCCTGCAGTTCGTGCAGCCGGGTGTCGAGGTGAAGACC
GTGCCGGCGAAGAATGTCGCGTCCGCGCAGAAGGCCGACGCCGCTCCGGCGAAAACCGACAGCAAGGGCTGA


Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 650


>gb|AAG03814.1|+|MexA [Pseudomonas aeruginosa PAO1]
MQRTPAMRVLVPALLVAISALSGCGKSEAPPPAQTPEVGIVTLEAQTVTLNTELPGRTNAFRIAEVRPQVNGIILKRLFKEGSDVKAGQQ
LYQIDPATYEADYQSAQANLASTQEQAQRYKLLVADQAVSKQQYADANAAYLQSKAAVEQARINLRYTKVLSPISGRIGRSAVTEGALVT
NGQANAMATVQQLDPIYVDVTQPSTALLRLRRELASGQLERAGDNAAKVSLKLEDGSQYPLEGRLEFSEVSVDEGTGSVTIRAVFPNPNN
ELLPGMFVHAQLQEGVKQKAILAPQQGVTRDLKGQATALVVNAQNKVELRVIKADRVIGDKWLVTEGLNAGDKIITEGLQFVQPGVEVKT
VPAKNVASAQKADAAPAKTDSKG


>gb|AE004091.2|+|472024-473175|MexA [Pseudomonas aeruginosa PAO1]
ATGCAACGAACGCCAGCCATGCGTGTACTGGTTCCGGCCCTGCTGGTCGCGATTTCGGCCCTTTCCGGGTGCGGAAAAAGCGAGGCGCCG
CCGCCGGCGCAAACGCCGGAGGTCGGGATCGTGACCCTGGAAGCGCAGACGGTGACCCTGAATACCGAGCTGCCGGGCCGGACCAATGCG
TTCCGCATCGCCGAGGTGCGTCCCCAGGTGAACGGCATCATCCTCAAGCGCCTGTTCAAGGAAGGCAGCGACGTCAAGGCCGGGCAGCAG
CTCTACCAGATCGACCCCGCCACCTACGAGGCCGACTACCAGAGCGCCCAGGCCAACCTGGCTTCGACCCAGGAACAGGCCCAGCGCTAC
AAGCTGCTGGTCGCCGACCAGGCCGTGAGCAAGCAGCAGTACGCCGACGCCAATGCCGCCTACCTGCAGTCCAAGGCGGCGGTGGAGCAG
GCGCGGATCAACCTGCGCTACACCAAGGTGCTGTCGCCGATCTCCGGCCGCATCGGCCGTTCCGCGGTGACCGAAGGCGCCCTGGTGACC
AACGGCCAGGCCAACGCGATGGCCACCGTGCAACAGCTCGACCCGATCTACGTCGACGTCACCCAGCCGTCCACCGCCCTGCTGCGCCTG
CGCCGCGAACTGGCCAGCGGCCAGTTGGAGCGCGCCGGCGACAACGCGGCGAAGGTCTCCCTGAAGCTGGAGGACGGTAGCCAATACCCG
CTGGAAGGTCGCCTCGAATTCTCCGAGGTTTCCGTCGACGAAGGCACCGGCTCGGTCACCATCCGCGCCGTGTTCCCCAACCCGAACAAC
GAGCTGCTGCCCGGCATGTTCGTTCACGCGCAGTTGCAGGAAGGCGTCAAGCAGAAGGCCATCCTCGCTCCGCAGCAAGGCGTGACCCGC
GACCTCAAGGGCCAGGCTACCGCGCTGGTGGTGAACGCGCAGAACAAGGTCGAGCTGCGGGTGATCAAGGCCGACCGGGTGATCGGCGAC
AAGTGGCTGGTTACCGAAGGCCTGAACGCCGGCGACAAGATCATTACCGAAGGCCTGCAGTTCGTGCAGCCGGGTGTCGAGGTGAAGACC
GTGCCGGCGAAGAATGTCGCGTCCGCGCAGAAGGCCGACGCCGCTCCGGCGAAAACCGACAGCAAGGGCTGA