Accession ARO:3000378
DefinitionMexB is the inner membrane multidrug exporter of the efflux complex MexAB-OprM.
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump
Drug Classpeptide antibiotic, tetracycline antibiotic, sulfonamide antibiotic, penam, diaminopyrimidine antibiotic, macrolide antibiotic, glycylcycline, phenicol antibiotic, aminoglycoside antibiotic, monobactam, carbapenem, cephalosporin, fluoroquinolone antibiotic, acridine dye, aminocoumarin antibiotic, antibacterial free fatty acids, triclosan, cephamycin, penem
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Classification58 ontology terms | Show
+ process or component of antibiotic biology or chemistry
+ antibiotic molecule
+ peptide antibiotic [Drug Class]
+ mechanism of antibiotic resistance
+ resistance-modifying agents
+ lipopeptide antibiotic
+ beta-lactam antibiotic
+ tetracycline antibiotic [Drug Class]
+ cephem
+ antibiotic without defined classification
+ sulfonamide antibiotic [Drug Class]
+ penam [Drug Class]
+ antibiotic efflux [Resistance Mechanism]
+ diaminopyrimidine antibiotic [Drug Class]
+ polymyxin antibiotic
+ beta-lactamase inhibitor
+ determinant of antibiotic resistance
+ amoxicillin [Antibiotic]
+ macrolide antibiotic [Drug Class]
+ glycylcycline [Drug Class]
+ antibiotic mixture
+ trimethoprim [Antibiotic]
+ phenicol antibiotic [Drug Class]
+ aminoglycoside antibiotic [Drug Class]
+ colistin
+ monobactam [Drug Class]
+ sulfamethoxazole [Antibiotic]
+ carbapenem [Drug Class]
+ cephalosporin [Drug Class]
+ clavulanic acid [Adjuvant]
+ fluoroquinolone antibiotic [Drug Class]
+ efflux pump complex or subunit conferring antibiotic resistance [Efflux Component]
+ acridine dye [Drug Class]
+ aminocoumarin antibiotic [Drug Class]
+ antibacterial free fatty acids [Drug Class]
+ triclosan [Drug Class]
+ resistance-nodulation-cell division (RND) antibiotic efflux pump [AMR Gene Family]
+ colistin A [Antibiotic]
+ cephamycin [Drug Class]
+ azithromycin [Antibiotic]
+ ceftriaxone [Antibiotic]
+ ceftazidime [Antibiotic]
+ tetracycline [Antibiotic]
+ erythromycin [Antibiotic]
+ colistin B [Antibiotic]
+ amoxicillin-clavulanic acid
+ trimethoprim-sulfamethoxazole [Antibiotic]
+ chloramphenicol [Antibiotic]
+ ampicillin [Antibiotic]
+ ciprofloxacin [Antibiotic]
+ panipenem [Antibiotic]
+ aztreonam [Antibiotic]
+ novobiocin [Antibiotic]
+ penem [Drug Class]
+ meropenem [Antibiotic]
+ MexAB-OprM
+ nalidixic acid [Antibiotic]
+ ticarcillin [Antibiotic]
Parent Term(s)7 ontology terms | Show
Publications

Sennhauser G, et al. 2009. J Mol Biol 389(1): 134-145. Crystal structure of the multidrug exporter MexB from Pseudomonas aeruginosa. (PMID 19361527)

Bhatt FH and Jeffery CJ. 2010. J Vis Exp 46. Expression, detergent solubilization, and purification of a membrane transporter, the MexB multidrug resistance protein. (PMID 21178960)

Welch A, et al. 2010. Biochem J 430(2): 355-364. Promiscuous partnering and independent activity of MexB, the multidrug transporter protein from Pseudomonas aeruginosa. (PMID 20583998)

Middlemiss JK and Poole K. 2004. J Bacteriol 186(5): 1258-1269. Differential impact of MexB mutations on substrate selectivity of the MexAB-OprM multidrug efflux pump of Pseudomonas aeruginosa. (PMID 14973037)

Resistomes

Prevalence of MexB among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Citrobacter freundii0%0%0%
Enterobacter cloacae0%0%0%
Escherichia coli0%0%0%
Klebsiella oxytoca0%0%0%
Klebsiella pneumoniae0%0%0%
Neisseria meningitidis0%0%0.06%
Proteus mirabilis0%0%0%
Pseudomonas aeruginosa0%0%0%
Pseudomonas fluorescens3.7%0%0%
Stenotrophomonas maltophilia0%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 1950


>gb|AAA74437.1|+|MexB [Pseudomonas aeruginosa]
MSKFFIDRPIFAWVIALVIMLAGGLSILSLPVNQYPAIAPPAIAVQVSYPGASAETVQDTVVQVIEQQMNGIDNLRYISSESNSDGSMTT
TVTFEQGTDPDIAQVQVQNKLQLATPLLPQEVQRQGIRVTKAVKNFLMVVGVVSTDGSMTKEDLSNYIVSNIQDPLSRTKGVGDFQVFGS
QYSMRIWLDPAKLNSYQLTPGDVSSAIQAQNVQISSGQLGGLPAVKGQQLNATIIGKTRLQTAEQFENILLKVNPDGSQVRLKDVADVGL
GGQDYSINAQFNGSPASGIAIKLATGANALDTAKAIRQTIANLEPFMPQGMKVVYPYDTTPVVSASIHEVVKTLGEAILLVFLVMYLFLQ
NFRATLIPTIAVPVVLLGTFGVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERVMAEEGLSPREAARKSMGQIQGALVGIAMVLS
AVFLPMAFFGGSTGVIYRQFSITIVSAMALSVIVALILTPALCATMLKPIEKGDHGEHKGGFFGWFNRMFLSTTHGYERGVASILKHRAP
YLLIYVVIVAGMIWMFTRIPTAFLPDEDQGVLFAQVQTPPGSSAERTQVVVDSMREYLLEKESSSVSSVFTVTGFNFAGRGQSSGMAFIM
LKPWEERPGGENSVFELAKRAQMHFFSFKDAMVFAFAPPSVLELGNATGFDLFLQDQAGVGHEVLLQARNKFLMLAAQNPALQRVRPNGM
SDEPQYKLEIDDEKASALGVSLADINSTVSIAWGSSYVNDFIDRGRVKRVYLQGRPDARMNPDDLSKWYVRNDKGEMVPFNAFATGKWEY
GSPKLERYNGVPAMEILGEPAPGLSSGDAMAAVEEIVKQLPKGVGYSWTGLSYEERLSGSQAPALYALSLLVVFLCLAALYESWSIPFSV
MLVVPLGVIGALLATSMRGLSNDVFFQVGLLTTIGLSAKNAILIVEFAKELHEQGKGIVEAAIEACRMRLRPIVMTSLAFILGVVPLAIS
TGAGSGSQHAIGTGVIGGMVTATVLAIFWVPLFYVAVSTLFKDEASKQQASVEKGQ


>gb|L11616|+|1570-4710|MexB [Pseudomonas aeruginosa]
ATGTCGAAGTTTTTCATTGATAGGCCCATTTTCGCGTGGGTGATCGCCTTGGTGATCATGCTCGCGGGCGGCCTGTCGATCCTCAGTCTG
CCGGTCAACCAGTACCCGGCCATCGCCCCGCCGGCCATCGCCGTGCAGGTGAGCTACCCGGGCGCCTCGGCCGAGACGGTGCAGGACACC
GTGGTCCAGGTGATCGAGCAGCAGATGAACGGGATCGACAATCTGCGCTACATCTCCTCGGAGAGTAACTCCGACGGCAGCATGACCACC
ACCGTGACCTTCGAACAGGGCACCGACCCCGACATCGCCCAGGTCCAGGTGCAGAACAAGCTGCAACTGGCCACCCCGCTACTGCCGCAG
GAAGTGCAGCGCCAGGGGATCCGGGTGACCAAGGCGGTGAAGAACTTCCTCATGGTGGTCGGTGTGGTTTCCACCGACGGCAGCATGACC
AAGGAAGACCTGTCGAACTACATCGTTTCCAACATCCAGGACCCACTCTCGCGGACCAAGGGCGTCGGTGACTTCCAGGTGTTCGGCTCG
CAGTACTCGATGCGCATCTGGCTCGACCCGGCCAAGCTGAACAGCTACCAGCTGACCCCCGGCGACGTGAGCAGCGCGATCCAGGCGCAG
AACGTGCAGATTTCCTCCGGCCAGCTCGGCGGCTTGCCGGCGGTCAAGGGCCAGCAGCTCAACGCCACCATCATCGGCAAGACCCGCCTG
CAGACCGCGGAGCAATTCGAGAACATCCTGCTCAAGGTCAATCCCGACGGTTCCCAGGTGCGCCTGAAGGACGTCGCCGATGTAGGCCTG
GGCGGCCAGGACTACAGCATCAACGCGCAGTTCAACGGCAGCCCGGCGTCCGGTATCGCGATCAAGCTGGCCACCGGCGCCAACGCGCTG
GATACCGCCAAGGCGATCCGCCAGACCATCGCCAACCTGGAACCGTTCATGCCGCAGGGCATGAAGGTGGTCTACCCGTACGACACCACC
CCGGTGGTCTCGGCCTCGATCCATGAGGTAGTGAAGACCCTCGGCGAGGCGATCCTCCTCGTGTTCCTGGTGATGTACCTGTTCCTGCAG
AACTTCCGCGCCACGCTGATCCCGACCATCGCCGTACCGGTGGTGCTGCTGGGGACCTTCGGCGTGCTCGCCGCGTTCGGCTTCTCGATC
AACACCCTGACCATGTTCGGCATGGTGCTGGCCATCGGCTTGCTGGTGGACGACGCCATCGTGGTGGTGGAGAACGTCGAGCGGGTGATG
GCCGAGGAAGGCCTGTCGCCAAGGGAGGCGGCGCGCAAGTCCATGGGCCAGATCCAGGGCGCGCTGGTCGGTATCGCCATGGTGCTCTCG
GCGGTATTCCTGCCGATGGCGTTCTTCGGCGGCTCCACCGGGGTGATCTACCGGCAGTTCTCCATCACCATCGTGTCGGCCATGGCCCTC
TCGGTGATCGTGGCGCTGATCCTCACCCCGGCGCTCTGCGCGACCATGCTCAAGCCGATCGAGAAAGGCGACCATGGCGAGCACAAGGGC
GGCTTCTTCGGCTGGTTCAACCGGATGTTCCTTTCCACCACCCACGGCTACGAGCGGGGCGTGGCGTCGATCCTCAAGCATCGCGCGCCG
TACCTGCTGATCTACGTGGTGATCGTGGCCGGGATGATCTGGATGTTCACCCGCATTCCCACCGCGTTCCTCCCCGACGAGGACCAGGGC
GTACTGTTCGCCCAGGTACAGACCCCGCCGGGCTCCAGTGCCGAGCGTACCCAGGTGGTGGTGGACTCGATGCGCGAATACCTGCTGGAG
AAGGAAAGCTCTTCGGTCAGCTCGGTGTTCACCGTGACCGGCTTCAACTTCGCCGGCCGCGGCCAGAGTTCGGGCATGGCGTTCATCATG
CTCAAGCCCTGGGAAGAGCGTCCCGGTGGCGAGAACAGCGTGTTCGAACTGGCCAAGCGCGCGCAGATGCACTTCTTCAGCTTCAAGGAC
GCGATGGTGTTCGCCTTCGCGCCGCCGTCGGTACTGGAACTGGGTAACGCCACCGGCTTCGACCTGTTCCTCCAGGACCAGGCGGGTGTC
GGCCACGAAGTCCTGCTCCAGGCGCGCAACAAGTTCCTCATGCTCGCCGCGCAGAACCCGGCGCTGCAACGCGTGCGCCCCAACGGCATG
AGCGACGAACCGCAGTACAAGCTGGAGATCGACGACGAGAAGGCCAGCGCCCTCGGCGTGTCCCTTGCCGACATCAACAGCACCGTGTCC
ATCGCCTGGGGTTCCAGCTACGTCAACGATTTCATCGACCGTGGCCGGGTCAAGCGGGTCTACCTGCAGGGCAGGCCGGACGCGCGGATG
AACCCGGACGACCTGAGCAAGTGGTACGTGCGCAACGACAAGGGCGAGATGGTGCCGTTCAACGCCTTCGCCACCGGCAAGTGGGAATAC
GGTTCGCCGAAGCTGGAGCGCTACAATGGCGTGCCGGCGATGGAGATCCTCGGCGAGCCGGCGCCCGGCCTGAGTTCCGGTGACGCCATG
GCGGCGGTCGAGGAGATCGTCAAGCAATTGCCGAAAGGCGTTGGCTACTCCTGGACCGGCCTGTCCTACGAGGAGCGCTTGTCCGGCTCG
CAGGCGCCGGCGCTGTATGCGCTGTCGCTGCTGGTGGTGTTCCTCTGCCTGGCGGCCCTGTACGAAAGCTGGTCGATTCCGTTCTCGGTG
ATGCTGGTGGTGCCGTTGGGCGTGATCGGTGCGCTGCTGGCGACGTCCATGCGCGGCCTGTCCAACGACGTGTTCTTCCAGGTGGGCCTG
TTGACGACCATCGGCCTGTCGGCGAAGAACGCCATTCTCATCGTGGAGTTCGCCAAGGAGCTGCACGAGCAGGGCAAGGGCATCGTCGAG
GCGGCCATCGAAGCCTGCCGCATGCGTCTGCGGCCGATCGTGATGACCTCCCTGGCGTTCATCCTCGGCGTGGTCCCGCTGGCGATCTCC
ACCGGCGCCGGCTCGGGCAGCCAGCATGCGATCGGTACCGGCGTGATCGGCGGCATGGTCACTGCGACCGTCCTGGCGATCTTCTGGGTA
CCGCTGTTCTACGTGGCGGTCAGCACGCTGTTCAAGGACGAGGCGTCCAAGCAGCAGGCGTCCGTCGAAAAGGGGCAATGA