mdtG

Accession ARO:3001329
Synonym(s)yceE
DefinitionThe MdtG protein, also named YceE, appears to be a member of the major facilitator superfamily of transporters, and it has been reported, when overexpressed, to increase fosfomycin and deoxycholate resistances. mdtG is a member of the marA-soxS-rob regulon.
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classtetracycline antibiotic, benzalkonium chloride, acridine dye, fluoroquinolone antibiotic, glycylcycline, fosfomycin, penam, oxazolidinone antibiotic, bicyclomycin, phenicol antibiotic, isoniazid, nucleoside antibiotic, antibacterial free fatty acids, nitroimidazole antibiotic, rhodamine, rifamycin antibiotic, cephalosporin, peptide antibiotic, lincosamide antibiotic, diaminopyrimidine antibiotic, macrolide antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
ResistomesEscherichia colig+wgs, Shigella dysenteriaewgs, Shigella flexneriwgs, Shigella sonneiwgs
Classification30 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic fosfomycin [Drug Class]
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
Publications

Fabrega A, et al. 2010. Antimicrob Agents Chemother 54(3): 1218-1225. Constitutive SoxS expression in a fluoroquinolone-resistant strain with a truncated SoxR protein and identification of a new member of the marA-soxS-rob regulon, mdtG. (PMID 20008776)

Resistomes

Prevalence of mdtG among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Citrobacter amalonaticus100%0%88.89%
Citrobacter freundii96.55%0%96.12%
Citrobacter koseri100%0%91.67%
Citrobacter youngae100%0%75%
Escherichia coli13.02%0%86.4%
Klebsiella oxytoca0%0%0.93%
Klebsiella pneumoniae0%0%0%
Salmonella enterica0.78%0%0.08%
Shigella dysenteriae100%0%97.14%
Shigella flexneri96.97%0%98.96%
Shigella sonnei100%0%99.84%
Staphylococcus aureus0%0%0%
Vibrio parahaemolyticus0%0%0.17%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 700


>gb|ABV18113.1|-|mdtG [Escherichia coli O139:H28 str. E24377A]
MSPCENDTPINWKRNLIVAWLGCFLTGAAFSLVMPFLPLYVEQLGVTGHSALNMWSGIVFSITFLFSAIASPFWGGLADRKGRKLMLLRS
ALGMGIVMVLMGLAQNIWQFLILRALLGLLGGFVPNANALIATQVPRNKSGWALGTLSTGGVSGALLGPMAGGLLADSYGLRPVFFITAS
VLILCFFVTLFCIREKFQPVSKKEMLHMREVVTSLKNPKLVLSLFVTTLIIQVATGSIAPILTLYVRELAGNVSNVAFISGMIASVPGVA
ALLSAPRLGKLGDRIGPEKILITALIFSVLLLIPMSYVQTPLQLGILRFLLGAADGALLPAVQTLLVYNSSNQIAGRIFSYNQSFRDIGN
VTGPLMGAAISANYGFRAVFLVTAGVVLFNAVYSWNSLRRRRIPQVSN


>gb|CP000800.1|-|1191728-1192954|mdtG [Escherichia coli O139:H28 str. E24377A]
ATGTCACCCTGTGAAAATGACACCCCTATAAACTGGAAACGAAACCTGATCGTCGCCTGGCTAGGCTGTTTTCTTACCGGGGCCGCCTTC
AGTCTGGTAATGCCCTTCTTACCCCTCTACGTTGAGCAGCTTGGTGTTACCGGCCACTCCGCCCTGAATATGTGGTCCGGTATTGTCTTC
AGCATTACATTTTTATTTTCGGCCATCGCCTCACCGTTTTGGGGTGGACTCGCCGACCGTAAAGGTCGAAAACTCATGCTATTACGCTCT
GCTCTCGGCATGGGCATCGTGATGGTGTTGATGGGACTGGCACAAAATATCTGGCAGTTTTTGATCCTACGGGCGCTTCTTGGGTTACTT
GGCGGATTTGTCCCCAACGCTAATGCTCTTATCGCCACACAAGTACCGCGTAATAAAAGCGGCTGGGCGCTGGGTACGCTCTCCACAGGC
GGCGTTAGTGGTGCGTTGCTCGGCCCAATGGCTGGCGGCCTGCTCGCCGATAGCTACGGCTTACGTCCGGTATTCTTTATTACCGCCAGT
GTGCTCATACTCTGCTTTTTCGTCACCCTGTTTTGCATCAGAGAAAAATTCCAGCCGGTCAGCAAAAAAGAGATGCTGCACATGCGGGAA
GTGGTGACATCACTTAAAAACCCGAAACTGGTACTCAGCCTGTTTGTCACTACGTTAATCATCCAGGTGGCGACGGGCTCAATTGCCCCC
ATTCTGACGCTGTATGTCCGCGAACTGGCGGGTAACGTCAGTAACGTCGCCTTTATCAGTGGCATGATCGCCTCGGTGCCAGGCGTGGCG
GCTCTGCTAAGTGCACCACGACTCGGCAAACTTGGCGATCGAATCGGACCCGAAAAGATCCTGATTACAGCGCTGATCTTTTCTGTACTG
CTGTTGATCCCAATGTCTTACGTTCAGACGCCATTGCAACTTGGGATTTTACGTTTTTTGCTCGGTGCCGCCGATGGTGCACTACTCCCC
GCCGTACAGACACTGTTGGTTTACAACTCGAGCAACCAGATCGCCGGGCGTATCTTCAGCTATAACCAATCGTTTCGTGATATTGGCAAC
GTTACCGGACCATTGATGGGAGCAGCGATTTCAGCGAACTACGGTTTCAGAGCGGTATTTCTCGTCACCGCTGGCGTAGTGTTATTCAAC
GCAGTCTATTCATGGAACAGTCTACGTCGTCGTCGAATACCCCAGGTATCGAACTGA