qacH

Accession ARO:3003836
DefinitionqacH is a subunit of the qac multidrug efflux pump in Vibrio cholerae
AMR Gene Familysmall multidrug resistance (SMR) antibiotic efflux pump
Drug Classphenicol antibiotic, aminocoumarin antibiotic, tetracycline antibiotic, aminoglycoside antibiotic, macrolide antibiotic, fluoroquinolone antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Classification11 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_drug_class fluoroquinolone antibiotic [Drug Class]
+ small multidrug resistance (SMR) antibiotic efflux pump [AMR Gene Family]
Publications

Ceccarelli D, et al. 2006. Antimicrob. Agents Chemother. 50(7):2493-9 New cluster of plasmid-located class 1 integrons in Vibrio cholerae O1 and a dfrA15 cassette-containing integron in Vibrio parahaemolyticus isolated in Angola. (PMID 16801431)

Resistomes

Prevalence of qacH among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Acinetobacter nosocomialis0%0%2%
Burkholderia cenocepacia0%0%4.73%
Burkholderia cepacia0%0%12.3%
Citrobacter freundii0%0%0.78%
Enterobacter cloacae0%0%1.13%
Enterobacter hormaechei0%0%3.01%
Escherichia coli0%0.16%1.35%
Klebsiella oxytoca0%0%0.93%
Proteus mirabilis4.35%0%2.59%
Salmonella enterica0%1.41%0.3%
Serratia marcescens0%0%0.46%
Shigella sonnei0%0%0.63%
Yersinia enterocolitica0%0%1.3%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 190


>gb|AAZ42322.1|+|qacH [Vibrio cholerae]
MKNWIFMAVAIFGEVIATSALKSSHGFTRLVPSVVVVAGYGLAFYFLSLALKSIPVGIAYAVWAGLGIVLVAAIAWIFHGQKLDFWAFIG
MGLIVSGVAVLNLLSKVSAH


>gb|DQ149925.1|+|189-521|qacH [Vibrio cholerae]
GTGAAGAACTGGATATTTATGGCTGTTGCAATCTTTGGCGAGGTCATCGCAACTTCCGCACTGAAGTCTAGCCATGGATTCACTAGGTTA
GTTCCTTCCGTTGTAGTTGTGGCTGGCTACGGGCTTGCGTTCTATTTCTTGTCTCTCGCGCTCAAGTCCATTCCGGTCGGTATTGCTTAC
GCTGTATGGGCTGGGCTTGGCATCGTGCTTGTGGCAGCTATTGCTTGGATTTTCCATGGCCAAAAACTAGACTTCTGGGCGTTCATTGGC
ATGGGACTTATCGTCAGTGGCGTCGCCGTTCTAAACCTGCTATCCAAGGTCAGCGCACATTGA