qacH

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3003836
CARD Short NameqacH
DefinitionqacH is a subunit of the qac multidrug efflux pump in Staphylococcus saprophyticus.
AMR Gene Familysmall multidrug resistance (SMR) antibiotic efflux pump
Drug Classdisinfecting agents and antiseptics
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONEscherichia coli (3), Listeria monocytogenes (3), Staphylococcus aureus (3), Salmonella (2)
GAZ
FOODON
ENVO
UBERON
Classification6 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ small multidrug resistance (SMR) antibiotic efflux pump [AMR Gene Family]
+ confers_resistance_to_drug_class disinfecting agents and antiseptics [Drug Class]
Publications

Heir E, et al. 1998. FEMS Microbiol. Lett. 163(1):49-56 The Staphylococcus qacH gene product: a new member of the SMR family encoding multidrug resistance. (PMID 9631545)

Resistomes

Prevalence of qacH among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
No prevalence data


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 190


>gb|CAA76544.1|+|qacH [Staphylococcus saprophyticus]
MPYLYLLLSIVSEVIGSAFLKSSDGFSKLYPTITTIISFLICFYFLSKTMQHLPLNITYASWAGLGLVLTTIVSVLIFKEQINLISIISI
ILIIFGVVLLNTFGSSH


>gb|Y16945.1|+|1862-2185|qacH [Staphylococcus saprophyticus]
ATGCCATATTTATATTTGTTATTATCAATAGTCAGTGAAGTAATAGGCAGTGCATTTTTAAAATCTTCAGACGGTTTCTCAAAATTATAT
CCAACTATAACAACAATCATTTCATTCCTTATTTGTTTTTATTTTCTGAGTAAAACTATGCAACATTTACCACTTAATATTACTTACGCA
AGTTGGGCAGGTTTAGGATTAGTATTAACAACAATTGTTTCAGTTCTTATTTTCAAAGAACAAATAAATTTAATAAGCATTATTTCAATT
ATTTTAATAATATTTGGTGTTGTTTTACTAAACACATTCGGATCATCACACTAA

Curator Acknowledgements
Curator Description Most Recent Edit