ArmR

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3004056
CARD Short NameArmR
DefinitionArmR, a 53-amino-acid antirepressor, allosterically inhibits MexR dimer-DNA binding by occupying a hydrophobic binding cavity within the center of the MexR dimer. ArmR up-regulation and MexR-ArmR complex formation have previously been shown to upregulate MexAB-OprM.
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump, antibiotic efflux regulatory protein
Drug Classpeptide antibiotic, nonribosomal peptide antibiotics, sulfonamide antibiotic, diaminopyrimidine antibiotic, penicillin beta-lactam, cephalosporin, phenicol antibiotic, aminocoumarin antibiotic, tetracycline antibiotic, carbapenem, monobactam, fluoroquinolone antibiotic, macrolide antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Efflux Regulatorprotein(s) or two-component regulatory system modulating antibiotic efflux
Classification45 ontology terms | Show
+ process or component of antibiotic biology or chemistry
+ antibiotic molecule
+ peptide antibiotic [Drug Class]
+ nonribosomal peptide antibiotics [Drug Class]
+ lipopeptide antibiotic
+ beta-lactam antibiotic
+ mechanism of antibiotic resistance
+ sulfonamide antibiotic [Drug Class]
+ diaminopyrimidine antibiotic [Drug Class]
+ penicillin beta-lactam [Drug Class]
+ determinant of antibiotic resistance
+ antibiotic efflux [Resistance Mechanism]
+ cephalosporin [Drug Class]
+ polymyxin antibiotic
+ penicillin with extended spectrum
+ third-generation cephalosporin [Drug Subclass]
+ antibiotic mixture
+ phenicol antibiotic [Drug Class]
+ sulfamethoxazole [Antibiotic]
+ trimethoprim [Antibiotic]
+ efflux pump complex or subunit conferring antibiotic resistance [Efflux Component]
+ aminocoumarin antibiotic [Drug Class]
+ tetracycline antibiotic [Drug Class]
+ colistin
+ carbapenem [Drug Class]
+ monobactam [Drug Class]
+ fluoroquinolone antibiotic [Drug Class]
+ macrolide antibiotic [Drug Class]
+ trimethoprim-sulfamethoxazole [Antibiotic]
+ panipenem [Antibiotic]
+ ampicillin [Antibiotic]
+ colistin B [Antibiotic]
+ colistin A [Antibiotic]
+ aztreonam [Antibiotic]
+ protein(s) or two-component regulatory system modulating antibiotic efflux [Efflux Regulator]
+ chloramphenicol [Antibiotic]
+ azithromycin [Antibiotic]
+ novobiocin [Antibiotic]
+ resistance-nodulation-cell division (RND) antibiotic efflux pump [AMR Gene Family]
+ meropenem [Antibiotic]
+ ceftriaxone [Antibiotic]
+ ceftazidime [Antibiotic]
+ tetracycline [Antibiotic]
+ ciprofloxacin [Antibiotic]
+ erythromycin [Antibiotic]
Parent Term(s)2 ontology terms | Show
+ indirectly_positively_regulates MexAB-OprM
+ antibiotic efflux regulatory protein [AMR Gene Family]
Sub-Term(s)
1 ontology terms | Show
+ nalC regulates
Resistomes with Perfect MatchesPseudomonas aeruginosag+wgs
Resistomes with Sequence VariantsPseudomonas aeruginosag+wgs
Publications

Wilke MS, et al. 2008. Proc Natl Acad Sci U S A 105(39): 14832-14837. The crystal structure of MexR from Pseudomonas aeruginosa in complex with its antirepressor ArmR. (PMID 18812515)

Daigle DM, et al. 2007. J. Bacteriol. 189(15):5441-51 Protein modulator of multidrug efflux gene expression in Pseudomonas aeruginosa. (PMID 17545281)

Resistomes

Prevalence of ArmR among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Pseudomonas aeruginosa0.61%0%36.89%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 100


>gb|AAG07106.1|-|ArmR [Pseudomonas aeruginosa PAO1]
MSLNTPRNKPSRTETEAVAASSGRSAVGRRDYTEQLRRAARRNAWDLYGEHFY


>gb|AE004091.2|-|4165719-4165880|ArmR [Pseudomonas aeruginosa PAO1]
ATGTCCCTGAACACTCCGCGCAACAAACCGTCCCGCACCGAGACCGAAGCTGTCGCTGCCAGCTCGGGACGATCCGCCGTCGGCCGGCGG
GATTACACCGAGCAGCTGCGCCGGGCAGCCCGGCGCAATGCCTGGGACCTCTACGGCGAGCACTTCTACTGA

Curator Acknowledgements
Curator Description Most Recent Edit