Acinetobacter baumannii AbaF

Accession ARO:3004573
Synonym(s)P0DPR5
DefinitionExpression of abaF in E. coli resulted in increased resistance to fosfomycin.
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classtetracycline antibiotic, benzalkonium chloride, bicyclomycin, nitroimidazole antibiotic, isoniazid, acridine dye, cephalosporin, rifamycin antibiotic, phenicol antibiotic, fluoroquinolone antibiotic, penam, glycylcycline, diaminopyrimidine antibiotic, macrolide antibiotic, nucleoside antibiotic, fosfomycin, oxazolidinone antibiotic, antibacterial free fatty acids, peptide antibiotic, lincosamide antibiotic, rhodamine
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
ResistomesAcinetobacter baumanniig+wgs, Acinetobacter nosocomialiswgs
Classification30 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_drug_class fosfomycin [Drug Class]
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
Publications

Sharma A, et al. 2017. J. Antimicrob. Chemother. 72(1):68-74 Fosfomycin resistance in Acinetobacter baumannii is mediated by efflux through a major facilitator superfamily (MFS) transporter-AbaF. (PMID 27650185)

Resistomes

Prevalence of Acinetobacter baumannii AbaF among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Acinetobacter baumannii92.99%0%94.8%
Acinetobacter nosocomialis50%0%42%
Proteus mirabilis0%0%0.86%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 700


>gb|ABO11759.2|-|Acinetobacter baumannii AbaF [Acinetobacter baumannii ATCC 17978]
MTTTLKKVVAASMVGSVAEWYEFFLYGTASALVFGELFFQQTGNAIDGILAAFALYAVGFLARPLGGLVFGHYGDKIGRKKLLQISLIIV
GITTFLMGCIPTFHQIGYWAPTLLVILRLIQGFAFGGEWGGAVILVSEHSPDDRRGYWASWPQTGVPLGNLVATLVLLLLSKNLSPEQFL
DWGWRCAFWFSAVVVLIGLWIRKNVDDAEVFKEAQAKQQLLEKQQLGIIEVLKYHKKSVIAGIGARFAENILYYMVVTFSISYLKLVVHK
DTSQILLLMFGAHLIHFFIIPFMGHLSDIFGRKPIYLIGAVLTAFWGFVGFPLMDTGNDWLIMLAIVLGLFIESMTYSPYSALMTELFPT
HIRYTALSFCYQVAPIMAGSLAPLIALTLLKEFNSSIPISLYLVAASLISIVSILLVKETKGRSLAFKD


>gb|CP000521.1|-|1557234-1558523|Acinetobacter baumannii AbaF [Acinetobacter baumannii ATCC 17978]
ATGACGACAACACTAAAAAAGGTAGTCGCGGCCTCTATGGTCGGCTCCGTAGCAGAATGGTATGAATTTTTCCTTTATGGCACCGCTTCT
GCCCTCGTCTTTGGCGAACTTTTCTTTCAACAAACTGGCAATGCTATAGATGGAATTTTGGCGGCCTTTGCTCTGTATGCCGTTGGCTTT
TTAGCAAGACCTCTCGGTGGCCTCGTGTTTGGTCACTACGGCGATAAAATTGGGCGCAAGAAATTATTGCAAATTAGCCTGATCATTGTC
GGTATCACTACTTTTTTAATGGGCTGTATTCCGACCTTTCATCAAATTGGCTATTGGGCTCCTACACTCCTAGTGATATTACGTTTAATT
CAAGGTTTTGCTTTTGGTGGTGAATGGGGCGGCGCAGTTATTTTAGTTTCAGAGCACAGTCCAGATGATCGCAGAGGTTATTGGGCAAGC
TGGCCACAAACTGGTGTACCGCTCGGAAATTTAGTAGCCACACTGGTTTTATTATTACTTTCAAAAAACCTCTCACCCGAACAATTTCTA
GATTGGGGGTGGCGCTGTGCATTCTGGTTCTCAGCAGTCGTGGTACTGATTGGTTTATGGATTCGAAAAAATGTAGACGATGCCGAAGTG
TTTAAAGAAGCACAGGCCAAACAACAGCTTCTTGAAAAGCAACAACTCGGGATTATTGAGGTTTTAAAATATCATAAGAAATCTGTTATT
GCGGGTATCGGTGCCAGATTTGCAGAAAATATTTTGTACTATATGGTGGTTACTTTTTCGATCAGTTATTTAAAGTTAGTCGTCCATAAA
GATACTTCGCAGATCTTACTGCTCATGTTCGGCGCTCATCTGATCCATTTCTTTATTATTCCTTTTATGGGGCATTTAAGCGATATATTT
GGCCGTAAACCTATTTACCTTATTGGGGCTGTACTTACTGCTTTTTGGGGTTTTGTCGGCTTTCCTTTAATGGATACAGGCAATGACTGG
CTCATTATGTTAGCAATTGTGCTTGGTTTATTTATTGAGTCCATGACCTACTCGCCTTACTCTGCGTTAATGACTGAGTTATTTCCAACT
CACATCCGCTATACGGCGCTTTCATTTTGTTATCAAGTCGCACCCATTATGGCAGGTTCGCTTGCTCCATTAATTGCCCTAACATTACTC
AAAGAATTTAATAGTTCGATTCCGATTTCTTTATATTTGGTTGCCGCAAGTCTGATTTCTATTGTCTCGATTTTGCTGGTGAAAGAAACC
AAAGGCCGATCTCTAGCTTTTAAAGATTAA