Mycobacterium tuberculosis ubiA mutations confer resistance to ethambutol

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3004950
Synonym(s)Rv3806c
CARD Short NameMtub_ubiA_EMB
DefinitionMutations in the ubiA gene contribute to or confer resistance to ethambutol.
AMR Gene Familyethambutol resistant ubiA
Drug Classpolyamine antibiotic
Resistance Mechanismantibiotic target alteration
Classification9 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic ethambutol [Antibiotic]
+ ethambutol resistant ubiA [AMR Gene Family]
Publications

Tulyaprawat O, et al. 2019. Tuberculosis (Edinb) 114:42-46 Association of ubiA mutations and high-level of ethambutol resistance among Mycobacterium tuberculosis Thai clinical isolates. (PMID 30711156)

Ezewudo M, et al. 2018. Sci Rep 8(1):15382 Integrating standardized whole genome sequence analysis with a global Mycobacterium tuberculosis antibiotic resistance knowledgebase. (PMID 30337678)

Resistomes

Prevalence of Mycobacterium tuberculosis ubiA mutations confer resistance to ethambutol among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein variant model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
No prevalence data


Detection Models

Model Type: protein variant model

Model Definition: Protein Variant Models (PVM) perform a similar search as Protein Homolog Models (PHM), i.e. detect protein sequences based on their similarity to a curated reference sequence, but secondarily screen query sequences for curated sets of mutations to differentiate them from antibiotic susceptible wild-type alleles. PVMs are designed to detect AMR acquired via mutation of house-keeping genes or antibiotic targets, e.g. a mutated gyrase resistant to aminocoumarin antibiotics. PVMs include a protein reference sequence (often from antibiotic susceptible wild-type alleles), a curated bit-score cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of single point mutations, insertions, or deletions curated from the scientific literature. A Strict RGI match has a BLASTP bit-score above the curated BLASTP cutoff value and contains at least one curated mutation from amongst the mapped resistance variants, while a Loose RGI match has a bit-score less than the curated BLASTP bit-score cut-off but still contains at least one curated mutation from amongst the mapped resistance variants.

Bit-score Cut-off (blastP): 525

PubMed: mutation data hand curated from the scientific literature, evaluated as conferring resistance (R). CRyPTIC: mutation data acquired from the CRyPTIC catalog, evaluated as resistant (R), susceptible (S), or undetermined (U). ReSeqTB: mutation data acquired from the ReSeqTB catalog, evaluated as conferring resistance (Minimal, Moderate, High), not conferring resistance (None), or Indeterminate. WHO: mutation data acquired from the WHO 2023 catalog, evaluated as resistant (R), susceptible (S), or undetermined (U).

MutationMutation typePubMedReSeqTBCRyPTICWHO
S173Asingle resistance variantno dataReSeqTB-Moderateno datano data
W175Csingle resistance variantno dataReSeqTB-Highno datano data
A237Vsingle resistance variantno dataReSeqTB-Highno datano data
R240Csingle resistance variantno dataReSeqTB-Highno datano data

>gb|NP_218323.1|-|Mycobacterium tuberculosis ubiA mutations confer resistance to ethambutol [Mycobacterium tuberculosis H37Rv]
MSEDVVTQPPANLVAGVVKAIRPRQWVKNVLVLAAPLAALGGGVRYDYVEVLSKVSMAFV
VFSLAASAVYLVNDVRDVEADREHPTKRFRPIAAGVVPEWLAYTVAVVLGVTSLAGAWML
TPNLALVMVVYLAMQLAYCFGLKHQAVVEICVVSSAYLIRAIAGGVATKIPLSKWFLLIM
AFGSLFMVAGKRYAELHLAERTGAAIRKSLESYTSTYLRFVWTLSATAVVLCYGLWAFER
DGYSGSWFAVSMIPFTIAILRYAVDVDGGLAGEPEDIALRDRVLQLLALAWIATVGAAVA
FG



>gb|NC_000962.3|-|4268925-4269833|Mycobacterium tuberculosis ubiA mutations confer resistance to ethambutol [Mycobacterium tuberculosis H37Rv]
ATGAGTGAAGATGTGGTGACTCAACCTCCGGCAAACCTGGTCGCCGGGGTGGTCAAGGCGATCCGCCCGCGCCAGTGGGTGAAAAACGTG
CTGGTGCTGGCCGCGCCGCTGGCCGCGTTGGGCGGCGGTGTCCGCTACGACTACGTCGAGGTGCTCAGCAAGGTGTCGATGGCCTTCGTG
GTGTTCAGCCTGGCCGCCTCGGCGGTGTACCTCGTCAACGATGTGCGTGACGTCGAGGCAGACCGGGAGCACCCCACCAAAAGGTTCCGG
CCGATCGCCGCCGGCGTGGTGCCCGAGTGGCTGGCGTACACCGTGGCGGTGGTACTGGGAGTGACATCGCTGGCCGGTGCCTGGATGCTG
ACCCCGAACCTGGCGCTGGTAATGGTCGTCTACCTCGCCATGCAGTTGGCGTATTGCTTTGGTCTCAAGCATCAAGCGGTGGTGGAAATC
TGCGTCGTGTCGTCGGCGTATTTGATCCGCGCCATCGCCGGGGGCGTGGCCACCAAAATCCCGCTGTCCAAGTGGTTTTTGCTGATCATG
GCATTCGGTTCGCTGTTCATGGTGGCCGGCAAGCGCTACGCCGAGCTGCATCTGGCCGAACGCACCGGCGCTGCGATCCGCAAGTCGCTG
GAAAGCTACACCAGCACCTATCTGCGGTTCGTCTGGACGTTGTCGGCCACCGCGGTGGTCTTGTGCTACGGGCTGTGGGCTTTCGAGCGC
GACGGCTACAGCGGGTCCTGGTTCGCGGTGTCGATGATTCCGTTCACCATCGCGATCCTGCGCTACGCGGTGGACGTCGATGGCGGCCTG
GCCGGGGAGCCGGAAGATATCGCGCTGCGTGACCGGGTATTGCAGCTGCTGGCGCTGGCGTGGATAGCAACGGTTGGGGCCGCTGTTGCC
TTCGGCTAG

Curator Acknowledgements
Curator Description Most Recent Edit