qacE

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3005009
CARD Short NameqacE
DefinitionQacE is a resistance gene conferring resistance to antiseptics.
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classdisinfecting agents and antiseptics
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONAcinetobacter baumannii (7), Pseudomonas aeruginosa (6), Escherichia coli (4), Klebsiella pneumoniae (3), Acinetobacter (2)
GAZ
FOODON
ENVOfarm (2)
UBERON
Classification6 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
+ confers_resistance_to_drug_class disinfecting agents and antiseptics [Drug Class]
Resistomes with Perfect MatchesKlebsiella michiganensiswgs, Providencia rettgeriwgs, Providencia stuartiip
Resistomes with Sequence VariantsAcinetobacter baumanniig+wgs, Burkholderia vietnamiensiswgs, Enterobacter hormaecheip+wgs, Escherichia coliwgs, Klebsiella michiganensiswgs, Klebsiella pneumoniaep+wgs, Proteus mirabiliswgs, Providencia rettgeriwgs, Providencia stuartiip, Pseudomonas aeruginosap+wgs, Serratia marcescenswgs, Sphingobium yanoikuyaewgs
Publications

Kazama H, et al. 1999. FEMS Microbiol. Lett. 174(2):379-84 Characterization of the antiseptic-resistance gene qacE delta 1 isolated from clinical and environmental isolates of Vibrio parahaemolyticus and Vibrio cholerae non-O1. (PMID 10339831)

Resistomes

Prevalence of qacE among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii0.18%0%0.03%0%0%
Burkholderia vietnamiensis0%0%0.86%0%0%
Enterobacter hormaechei0%0.06%0.13%0%0%
Escherichia coli0%0%0.01%0%0%
Klebsiella michiganensis0%0%0.8%0%0%
Klebsiella pneumoniae0%0.05%0.68%0%0%
Proteus mirabilis0%0%0.33%0%0%
Providencia rettgeri0%0%5.73%0%0%
Providencia stuartii0%6.82%0%0%0%
Pseudomonas aeruginosa0%0.58%0.09%0%0%
Serratia marcescens0%0%0.13%0%0%
Sphingobium yanoikuyae0%0%5.88%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 190


>gb|AEH26330.1|+|qacE [Klebsiella pneumoniae]
MKGWLFLVIAIVGEVIATSALKSSEGFTKLAPSAVVIIGYGIAFYFLSLVMKSIPVGVAYALWSGLGVVIITAIAWLLHGQKLDAWGFVG
MGLIVSGVVVLNLLSKASAH


>gb|HQ730118.1|+|5175-5507|qacE [Klebsiella pneumoniae]
ATGAAAGGCTGGCTTTTTCTTGTTATCGCAATAGTTGGCGAAGTAATCGCAACATCCGCATTAAAATCTAGCGAGGGCTTTACTAAGCTT
GCCCCTTCCGCCGTTGTCATAATCGGTTATGGCATCGCATTTTATTTTCTTTCTCTGGTTATGAAATCCATCCCTGTCGGTGTTGCTTAT
GCACTCTGGTCGGGACTCGGCGTCGTCATAATTACAGCCATTGCCTGGTTGCTTCATGGGCAAAAGCTTGATGCGTGGGGCTTTGTAGGT
ATGGGGCTCATAGTTAGTGGTGTAGTAGTTTTAAACTTGCTTTCCAAAGCAAGTGCCCACTAA

Curator Acknowledgements
Curator Description Most Recent Edit