qacL

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3005098
CARD Short NameqacL
DefinitionA subunit of the qac multidrug efflux pump in Vibrio cholerae.
AMR Gene Familysmall multidrug resistance (SMR) antibiotic efflux pump
Drug Classdisinfecting agents and antiseptics
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Classification6 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ small multidrug resistance (SMR) antibiotic efflux pump [AMR Gene Family]
+ confers_resistance_to_drug_class disinfecting agents and antiseptics [Drug Class]
Resistomes with Perfect MatchesPseudomonas aeruginosap+wgs
Resistomes with Sequence VariantsAchromobacter xylosoxidanswgs, Acinetobacter indicusp, Aeromonas hydrophilap+wgs, Aeromonas veroniig+wgs, Burkholderia cenocepaciag+wgs, Burkholderia cepaciawgs, Burkholderia vietnamiensiswgs, Citrobacter amalonaticuswgs, Citrobacter freundiiwgs, Citrobacter portucalensiswgs, Citrobacter werkmaniiwgs, Citrobacter youngaewgs, Enterobacter asburiaewgs, Enterobacter cloacaewgs, Enterobacter hormaecheip+wgs, Enterobacter kobeiwgs, Escherichia albertiiwgs, Escherichia colig+p+wgs, Escherichia fergusoniip+wgs, Klebsiella aerogeneswgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Laribacter hongkongensisg+wgs, Morganella morganiig+wgs, Pasteurella multocidag, Proteus mirabilisg+p+wgs, Providencia rettgeriwgs, Providencia stuartiip, Pseudomonas aeruginosap+wgs, Pseudomonas putidag+wgs, Salmonella entericag+p+wgs, Serratia marcescenswgs, Shigella boydiiwgs, Shigella dysenteriaeg, Shigella flexnerig+p, Shigella sonneiwgs, Vibrio choleraewgs, Vibrio parahaemolyticuswgs, Yersinia enterocoliticawgs
Publications

Ceccarelli D, et al. 2006. Antimicrob. Agents Chemother. 50(7):2493-9 New cluster of plasmid-located class 1 integrons in Vibrio cholerae O1 and a dfrA15 cassette-containing integron in Vibrio parahaemolyticus isolated in Angola. (PMID 16801431)

Resistomes

Prevalence of qacL among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Achromobacter xylosoxidans0%0%0.76%0%0%
Acinetobacter indicus0%1.89%0%0%0%
Aeromonas hydrophila0%2.6%0.81%0%0%
Aeromonas veronii3.64%0%1.12%0%0%
Burkholderia cenocepacia0.5%0%3.07%0%0%
Burkholderia cepacia0%0%7.17%0%0%
Burkholderia vietnamiensis0%0%0.86%0%0%
Citrobacter amalonaticus0%0%3.64%0%0%
Citrobacter freundii0%0%1.55%0%0%
Citrobacter portucalensis0%0%1.8%0%0%
Citrobacter werkmanii0%0%2.56%0%0%
Citrobacter youngae0%0%12.5%0%0%
Enterobacter asburiae0%0%0.4%0%0%
Enterobacter cloacae0%0%1.6%0%0%
Enterobacter hormaechei0%0.19%1.99%0%0%
Enterobacter kobei0%0%0.44%0%0%
Escherichia albertii0%0%1.94%0%0%
Escherichia coli0.4%1.31%6.95%0%1.91%
Escherichia fergusonii0%4.27%17.39%0%0%
Klebsiella aerogenes0%0%0.56%0%0%
Klebsiella michiganensis0%1.71%1.6%0%0%
Klebsiella oxytoca0%1.37%0.84%0%0%
Klebsiella pneumoniae0.65%0.93%3.65%0%0%
Klebsiella quasipneumoniae0%0.21%5.13%0%0%
Laribacter hongkongensis66.67%0%10.42%0%0%
Morganella morganii1.92%0%1.23%0%0%
Pasteurella multocida0.71%0%0%0%0%
Proteus mirabilis7.34%1.25%6.44%0%0%
Providencia rettgeri0%0%10.83%0%0%
Providencia stuartii0%2.27%0%0%0%
Pseudomonas aeruginosa0%2.05%1.45%0%0%
Pseudomonas putida1.41%0%1.07%0%0%
Salmonella enterica1.2%4.65%2.31%0%0%
Serratia marcescens0%0%0.52%0%0%
Shigella boydii0%0%4.44%0%0%
Shigella dysenteriae14.29%0%0%0%0%
Shigella flexneri1%3.61%0%0%0%
Shigella sonnei0%0%0.58%0%0%
Vibrio cholerae0%0%0.13%0%0%
Vibrio parahaemolyticus0%0%0.1%0%0%
Yersinia enterocolitica0%0%0.91%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 180


>gb|AAZ42322.1|+|qacL [Vibrio cholerae]
MKNWIFMAVAIFGEVIATSALKSSHGFTRLVPSVVVVAGYGLAFYFLSLALKSIPVGIAYAVWAGLGIVLVAAIAWIFHGQKLDFWAFIG
MGLIVSGVAVLNLLSKVSAH


>gb|DQ149925.1|+|189-521|qacL [Vibrio cholerae]
GTGAAGAACTGGATATTTATGGCTGTTGCAATCTTTGGCGAGGTCATCGCAACTTCCGCACTGAAGTCTAGCCATGGATTCACTAGGTTA
GTTCCTTCCGTTGTAGTTGTGGCTGGCTACGGGCTTGCGTTCTATTTCTTGTCTCTCGCGCTCAAGTCCATTCCGGTCGGTATTGCTTAC
GCTGTATGGGCTGGGCTTGGCATCGTGCTTGTGGCAGCTATTGCTTGGATTTTCCATGGCCAAAAACTAGACTTCTGGGCGTTCATTGGC
ATGGGACTTATCGTCAGTGGCGTCGCCGTTCTAAACCTGCTATCCAAGGTCAGCGCACATTGA

Curator Acknowledgements
Curator Description Most Recent Edit