sepA

Download Sequences
Accession ARO:3007012
CARD Short NamesepA
DefinitionsepA is a multidrug efflux pump that confers resistance to disinfecting agents and dyes.
AMR Gene Familysmall multidrug resistance (SMR) antibiotic efflux pump
Drug Classdisinfecting agents and antiseptics
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Resistomes with Sequence VariantsMacrococcus canisg+wgs, Staphylococcus arlettaeg+wgs, Staphylococcus aureusg+wgs, Staphylococcus capitisg+wgs, Staphylococcus epidermidisg+wgs, Staphylococcus equorumg+wgs, Staphylococcus haemolyticusg+wgs, Staphylococcus hominisg+wgs, Staphylococcus intermediuswgs, Staphylococcus lugdunensisg+p+wgs, Staphylococcus massiliensiswgs, Staphylococcus pasteurig+wgs, Staphylococcus pseudintermediusg+wgs, Staphylococcus saprophyticusg+wgs, Staphylococcus schleiferig+wgs, Staphylococcus simulansg+wgs, Staphylococcus warnerig+wgs
Classification7 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic acriflavine [Antibiotic]
+ small multidrug resistance (SMR) antibiotic efflux pump [AMR Gene Family]
+ confers_resistance_to_drug_class disinfecting agents and antiseptics [Drug Class]
Publications

Narui K, et al. 2002. Biol Pharm Bull 25(12):1533-6 Cloning and characterization of a novel chromosomal drug efflux gene in Staphylococcus aureus. (PMID 12499635)
Resistomes

Prevalence of sepA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Escherichia coli0%0%0%0%0%
Macrococcus canis100%0%100%0%0%
Staphylococcus arlettae100%0%95%0%0%
Staphylococcus aureus99.56%0%99.11%0%0%
Staphylococcus capitis100%0%100%0%0%
Staphylococcus epidermidis100%0%98.66%0%0%
Staphylococcus equorum100%0%98.21%0%0%
Staphylococcus haemolyticus96.55%0%99.12%0%0%
Staphylococcus hominis100%0%99.51%0%0%
Staphylococcus intermedius0%0%100%0%0%
Staphylococcus lugdunensis100%1.79%98.46%0%0%
Staphylococcus massiliensis0%0%85.71%0%0%
Staphylococcus pasteuri100%0%100%0%0%
Staphylococcus pseudintermedius100%0%99.49%0%0%
Staphylococcus saprophyticus100%0%97.9%0%0%
Staphylococcus schleiferi100%0%100%0%0%
Staphylococcus simulans100%0%100%0%0%
Staphylococcus warneri100%0%99.18%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 100


>gb|WP_042355600.1|-|sepA [Staphylococcus]
MIVNFFKHKFYNLLTTMIVLFVFVLSGAIFLTFLGFGLYGLSRILIYFRLGDFTYNRNMYDNLLYYGSYIIFGYFIIFAVEHLMDYFRKM
LPENAYFRGATFHLISYTVATTLFYFIIHLHYVYINIDFWVIMVIIGFLYVCKLQFYPESKNLNNRK


>gb|NC_016941.1|-|2187140-2187613|sepA [Staphylococcus]
ATGATTGTGAACTTTTTCAAGCATAAATTTTATAATTTATTAACTACAATGATTGTTCTCTTTGTGTTTGTGTTGTCCGGTGCAATTTTT
TTAACATTTCTAGGTTTTGGACTTTATGGTCTTAGCAGGATACTTATATACTTTAGGTTAGGTGATTTCACGTATAATAGAAATATGTAT
GATAATTTATTGTATTACGGTAGTTATATCATATTTGGTTATTTTATCATTTTTGCAGTCGAACATTTAATGGATTATTTTAGAAAGATG
CTTCCTGAAAATGCATATTTTAGAGGAGCAACATTCCATTTAATATCTTATACGGTTGCTACTACATTATTTTATTTCATTATTCATTTA
CATTATGTGTATATTAATATTGATTTTTGGGTCATCATGGTAATCATAGGCTTTCTTTATGTATGTAAACTTCAATTTTACCCTGAAAGT
AAAAATCTCAATAATAGAAAATAA

Curator Acknowledgements
Curator Description Most Recent Edit