Mycobacterium tuberculosis atpE with mutation conferring resistance to bedaquiline

Accession ARO:3007854
CARD Short NameMtub_atpE_BDQ
DefinitionGenetic variants of ATPase subunit C atpE with mutations associated with resistance to bedaquiline antibiotics.
AMR Gene Familyantibiotic resistant ATP synthase
Drug Classdiarylquinoline antibiotic
Resistance Mechanismantibiotic target alteration
Classification8 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic bedaquiline [Antibiotic]
+ antibiotic resistant ATP synthase [AMR Gene Family]
Publications

World Health Organization. 2023. ISBN 978-92-4-008241-0. Catalogue of mutations in Mycobacterium tuberculosis complex and their association with drug resistance. Second Edition. (ISBN 978-92-4-008241-0)

Resistomes

Prevalence of Mycobacterium tuberculosis atpE with mutation conferring resistance to bedaquiline among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein variant model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
No prevalence data


Detection Models

Model Type: protein variant model

Model Definition: Protein Variant Models (PVM) perform a similar search as Protein Homolog Models (PHM), i.e. detect protein sequences based on their similarity to a curated reference sequence, but secondarily screen query sequences for curated sets of mutations to differentiate them from antibiotic susceptible wild-type alleles. PVMs are designed to detect AMR acquired via mutation of house-keeping genes or antibiotic targets, e.g. a mutated gyrase resistant to aminocoumarin antibiotics. PVMs include a protein reference sequence (often from antibiotic susceptible wild-type alleles), a curated bit-score cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of single point mutations, insertions, or deletions curated from the scientific literature. A Strict RGI match has a BLASTP bit-score above the curated BLASTP cutoff value and contains at least one curated mutation from amongst the mapped resistance variants, while a Loose RGI match has a bit-score less than the curated BLASTP bit-score cut-off but still contains at least one curated mutation from amongst the mapped resistance variants.

Bit-score Cut-off (blastP): 100

PubMed: mutation data hand curated from the scientific literature, evaluated as conferring resistance (R). CRyPTIC: mutation data acquired from the CRyPTIC catalog, evaluated as resistant (R), susceptible (S), or undetermined (U). ReSeqTB: mutation data acquired from the ReSeqTB catalog, evaluated as conferring resistance (Minimal, Moderate, High), not conferring resistance (None), or Indeterminate. WHO: mutation data acquired from the WHO 2023 catalog, evaluated as resistant (R), susceptible (S), or undetermined (U).

MutationMutation typePubMedReSeqTBCRyPTICWHO
D28Gsingle resistance variantno datano datano dataWHO-R
D28Vsingle resistance variantno datano datano dataWHO-R
D28Asingle resistance variantno datano datano dataWHO-R
E61Dsingle resistance variantno datano datano dataWHO-R
A63Psingle resistance variantno datano datano dataWHO-R
I66Msingle resistance variantno datano datano dataWHO-R

>gb|NP_215821.1|+|Mycobacterium tuberculosis atpE with mutation conferring resistance to bedaquiline [Mycobacterium tuberculosis H37Rv]
MDPTIAAGALIGGGLIMAGGAIGAGIGDGVAGNALISGVARQPEAQGRLFTPFFITVGLV
EAAYFINLAFMALFVFATPVK



>gb|NC_000962.3|+|1461045-1461290|Mycobacterium tuberculosis atpE with mutation conferring resistance to bedaquiline [Mycobacterium tuberculosis H37Rv]
ATGGACCCCACTATCGCTGCCGGCGCCCTCATCGGCGGTGGACTGATCATGGCCGGTGGCGCCATCGGCGCCGGTATCGGTGACGGTGTC
GCCGGTAACGCGCTTATCTCCGGTGTCGCCCGGCAACCCGAGGCGCAAGGGCGGCTGTTCACACCGTTCTTCATCACCGTCGGTTTGGTT
GAGGCGGCATACTTCATCAACCTGGCGTTTATGGCGCTGTTCGTCTTCGCTACACCCGTCAAGTAA

Curator Acknowledgements
Curator Description Most Recent Edit