emrB

Download Sequences

Accession	ARO:3000074
CARD Short Name	emrB
Definition	emrB is a translocase in the emrB -TolC efflux protein in E. coli. It recognizes substrates including carbonyl cyanide m-chlorophenylhydrazone (CCCP), nalidixic acid, and thioloactomycin.
AMR Gene Family	major facilitator superfamily (MFS) antibiotic efflux pump
Drug Class	fluoroquinolone antibiotic
Resistance Mechanism	antibiotic efflux
Efflux Component	efflux pump complex or subunit conferring antibiotic resistance
Resistomes with Perfect Matches	Escherichia coli^g+p+wgs, Escherichia fergusonii^g+wgs, Shigella boydii^g+wgs, Shigella dysenteriae^g+wgs, Shigella flexneri^g+wgs, Shigella sonnei^g+wgs
Resistomes with Sequence Variants	Citrobacter amalonaticus^g+wgs, Citrobacter freundii^g+wgs, Citrobacter koseri^g+wgs, Citrobacter portucalensis^g+wgs, Citrobacter werkmanii^g+wgs, Citrobacter youngae^g+wgs, Cronobacter dublinensis^g+wgs, Cronobacter malonaticus^g+wgs, Cronobacter sakazakii^g+wgs, Cronobacter turicensis^wgs, Cronobacter universalis^g+wgs, Enterobacter asburiae^g+wgs, Enterobacter cancerogenus^g+wgs, Enterobacter chengduensis^g+wgs, Enterobacter cloacae^g+p+wgs, Enterobacter hormaechei^g+p+wgs, Enterobacter kobei^g+wgs, Enterobacter roggenkampii^g+wgs, Escherichia albertii^g+wgs, Escherichia coli^g+p+wgs, Escherichia fergusonii^g+wgs, Escherichia marmotae^g+wgs, Leclercia adecarboxylata^g+wgs, Salmonella bongori^g+wgs, Salmonella enterica^g+p+wgs, Shigella boydii^g+wgs, Shigella dysenteriae^g+wgs, Shigella flexneri^g+wgs, Shigella sonnei^g+wgs
Classification	9 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic molecule + antibiotic efflux [Resistance Mechanism] + efflux pump complex or subunit conferring antibiotic resistance [Efflux Component] + fluoroquinolone antibiotic [Drug Class] + nalidixic acid [Antibiotic] + major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
Parent Term(s)	2 ontology terms \| Show + part_of EmrAB-TolC + subunit of efflux pump conferring antibiotic resistance
Publications	Lomovskaya O, et al. 1992. Proc. Natl. Acad. Sci. U.S.A. 89(19):8938-42 Emr, an Escherichia coli locus for multidrug resistance. (PMID 1409590)

Resistomes

Prevalence of emrB among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Citrobacter amalonaticus	0%	0%	0%	0%	0%
Citrobacter amalonaticus	100%	0%	100%	0%	0%
Citrobacter freundii	77.87%	0%	95.36%	0%	0%
Citrobacter freundii	0%	0%	0%	0%	0%
Citrobacter koseri	100%	0%	100%	0%	0%
Citrobacter koseri	0%	0%	0%	0%	0%
Citrobacter portucalensis	0%	0%	0%	0%	0%
Citrobacter portucalensis	100%	0%	100%	0%	0%
Citrobacter werkmanii	0%	0%	0%	0%	0%
Citrobacter werkmanii	71.43%	0%	100%	0%	0%
Citrobacter youngae	100%	0%	100%	0%	0%
Citrobacter youngae	0%	0%	0%	0%	0%
Cronobacter dublinensis	0%	0%	0%	0%	0%
Cronobacter dublinensis	66.67%	0%	84.62%	0%	0%
Cronobacter malonaticus	100%	0%	98.18%	0%	0%
Cronobacter malonaticus	0%	0%	0%	0%	0%
Cronobacter sakazakii	0%	0%	0%	0%	0%
Cronobacter sakazakii	100%	0%	95.52%	0%	0%
Cronobacter turicensis	0%	0%	0%	0%	0%
Cronobacter turicensis	0%	0%	100%	0%	0%
Cronobacter universalis	0%	0%	0%	0%	0%
Cronobacter universalis	100%	0%	100%	0%	0%
Enterobacter asburiae	100%	0%	98.81%	0%	0%
Enterobacter asburiae	0%	0%	0%	0%	0%
Enterobacter cancerogenus	100%	0%	100%	0%	0%
Enterobacter cancerogenus	0%	0%	0%	0%	0%
Enterobacter chengduensis	100%	0%	100%	0%	0%
Enterobacter chengduensis	0%	0%	0%	0%	0%
Enterobacter cloacae	98.21%	0.56%	96.17%	0%	0%
Enterobacter cloacae	0%	0%	0%	0%	0%
Enterobacter hormaechei	0%	0%	0%	0%	0%
Enterobacter hormaechei	99.28%	0.06%	98.92%	0%	0%
Enterobacter kobei	0%	0%	0%	0%	0%
Enterobacter kobei	100%	0%	99.13%	0%	0%
Enterobacter roggenkampii	0%	0%	0%	0%	0%
Enterobacter roggenkampii	97.67%	0%	97.48%	0%	0%
Escherichia albertii	88.57%	0%	97.42%	0%	0%
Escherichia albertii	0%	0%	0%	0%	0%
Escherichia coli	52.38%	0.01%	71.97%	0%	90.91%
Escherichia coli	67.48%	0.01%	98.52%	0%	99.34%
Escherichia fergusonii	13.11%	0%	10.87%	0%	0%
Escherichia fergusonii	100%	0%	100%	0%	0%
Escherichia marmotae	100%	0%	93.75%	0%	0%
Escherichia marmotae	0%	0%	0%	0%	0%
Leclercia adecarboxylata	0%	0%	0%	0%	0%
Leclercia adecarboxylata	100%	0%	100%	0%	0%
Salmonella bongori	100%	0%	100%	0%	0%
Salmonella bongori	0%	0%	0%	0%	0%
Salmonella enterica	0%	0%	0%	0%	0%
Salmonella enterica	94.38%	0.05%	98.02%	0%	0%
Shigella boydii	20%	0%	23.33%	0%	0%
Shigella boydii	93.33%	0%	93.33%	0%	0%
Shigella dysenteriae	21.43%	0%	10%	0%	0%
Shigella dysenteriae	28.57%	0%	70%	0%	0%
Shigella flexneri	33%	0%	1.24%	0%	0%
Shigella flexneri	98%	0%	95.81%	0%	0%
Shigella sonnei	100%	0%	98.69%	0%	0%
Shigella sonnei	21.95%	0%	20.96%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 900

Protein
DNA

>gb|AAC75733.1|+|emrB [Escherichia coli str. K-12 substr. MG1655]
MQQQKPLEGAQLVIMTIALSLATFMQVLDSTIANVAIPTIAGNLGSSLSQGTWVITSFGVANAISIPLTGWLAKRVGEVKLFLWSTIAFA
IASWACGVSSSLNMLIFFRVIQGIVAGPLIPLSQSLLLNNYPPAKRSIALALWSMTVIVAPICGPILGGYISDNYHWGWIFFINVPIGVA
VVLMTLQTLRGRETRTERRRIDAVGLALLVIGIGSLQIMLDRGKELDWFSSQEIIILTVVAVVAICFLIVWELTDDNPIVDLSLFKSRNF
TIGCLCISLAYMLYFGAIVLLPQLLQEVYGYTATWAGLASAPVGIIPVILSPIIGRFAHKLDMRRLVTFSFIMYAVCFYWRAYTFEPGMD
FGASAWPQFIQGFAVACFFMPLTTITLSGLPPERLAAASSLSNFTRTLAGSIGTSITTTMWTNRESMHHAQLTESVNPFNPNAQAMYSQL
EGLGMTQQQASGWIAQQITNQGLIISANEIFWMSAGIFLVLLGLVWFAKPPFGAGGGGGGAH

>gb|U00096.1|+|2812616-2814154|emrB [Escherichia coli str. K-12 substr. MG1655]
ATGCAACAGCAAAAACCGCTGGAAGGCGCGCAACTGGTCATTATGACGATTGCGCTGTCACTGGCGACATTCATGCAGGTGCTGGACTCC
ACCATTGCTAACGTGGCGATCCCCACTATCGCCGGGAATCTGGGCTCATCGCTCAGCCAGGGAACGTGGGTAATCACTTCTTTCGGGGTG
GCGAATGCCATCTCGATCCCGCTTACCGGCTGGCTGGCAAAGCGCGTCGGGGAAGTGAAACTGTTCCTTTGGTCCACCATCGCCTTTGCT
ATTGCGTCGTGGGCGTGTGGTGTCTCCAGCAGCCTGAATATGCTGATCTTCTTCCGCGTGATTCAGGGGATTGTCGCCGGGCCGTTGATC
CCGCTTTCGCAAAGTCTATTGCTGAATAACTACCCGCCAGCCAAACGCTCGATCGCGCTGGCGTTGTGGTCGATGACGGTGATTGTCGCG
CCAATTTGCGGCCCGATCCTCGGCGGTTATATCAGCGATAATTACCACTGGGGCTGGATATTCTTCATCAACGTGCCGATTGGCGTGGCG
GTGGTGTTGATGACACTGCAAACTCTGCGCGGACGTGAAACCCGCACCGAACGGCGGCGGATTGATGCCGTGGGGCTGGCACTGCTGGTT
ATTGGTATCGGCAGCCTGCAGATTATGCTCGACCGCGGTAAAGAGCTGGACTGGTTTTCATCACAGGAAATTATCATCCTTACCGTGGTG
GCGGTGGTGGCTATCTGCTTCCTGATTGTCTGGGAGCTGACCGACGATAACCCGATAGTCGATCTGTCGTTGTTTAAGTCGCGCAACTTC
ACCATCGGCTGCTTGTGTATCAGCCTCGCGTATATGCTCTACTTCGGCGCTATTGTTCTGCTGCCGCAGTTGTTGCAGGAGGTCTACGGT
TACACGGCGACCTGGGCAGGTTTGGCCTCTGCGCCGGTAGGGATTATTCCGGTGATCCTGTCGCCGATTATCGGCCGCTTCGCGCATAAA
CTGGATATGCGGCGGCTGGTAACCTTCAGCTTTATTATGTATGCCGTCTGCTTCTACTGGCGTGCCTATACCTTTGAACCAGGTATGGAT
TTTGGCGCGTCGGCCTGGCCGCAGTTTATCCAGGGGTTTGCGGTGGCCTGCTTCTTTATGCCGCTGACCACCATTACGCTGTCTGGTTTG
CCACCGGAACGACTGGCGGCGGCATCGAGCCTCTCTAACTTTACGCGAACGCTGGCGGGGTCTATCGGCACGTCGATAACCACGACCATG
TGGACCAACCGCGAGTCGATGCACCATGCGCAGTTGACTGAGTCGGTAAACCCGTTCAACCCGAATGCCCAGGCGATGTACAGTCAACTG
GAAGGGCTTGGGATGACGCAACAGCAGGCATCAGGCTGGATTGCCCAGCAGATCACCAATCAGGGGCTGATTATTTCCGCCAATGAGATC
TTCTGGATGTCAGCCGGGATATTCCTCGTCCTGCTGGGGCTGGTGTGGTTTGCTAAACCGCCATTTGGCGCAGGTGGCGGCGGAGGCGGT
GCGCACTAA

Curator Acknowledgements

Curator	Description	Most Recent Edit

emrB

Prevalence: protein homolog model (view sequences)

Graph