emrB

Accession ARO:3000074
CARD Short NameemrB
DefinitionemrB is a translocase in the emrB -TolC efflux protein in E. coli. It recognizes substrates including carbonyl cyanide m-chlorophenylhydrazone (CCCP), nalidixic acid, and thioloactomycin.
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classfluoroquinolone antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Resistomes with Perfect MatchesEscherichia colig+p+wgs, Escherichia fergusoniig+wgs, Shigella boydiig+wgs, Shigella dysenteriaewgs, Shigella flexnerig+wgs, Shigella sonneig+wgs
Resistomes with Sequence VariantsAcinetobacter baumanniiwgs, Burkholderia cepaciawgs, Citrobacter amalonaticusg+wgs, Citrobacter freundiig+wgs, Citrobacter koserig+wgs, Citrobacter portucalensisg+wgs, Citrobacter werkmaniig+wgs, Citrobacter youngaeg+wgs, Cronobacter sakazakiig+wgs, Enterobacter asburiaeg+wgs, Enterobacter chengduensisg+wgs, Enterobacter cloacaeg+p+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeig+wgs, Enterobacter roggenkampiig+wgs, Escherichia albertiig+wgs, Escherichia colig+p+wgs, Escherichia fergusoniig+wgs, Escherichia marmotaeg+wgs, Klebsiella pneumoniaeg+wgs, Klebsiella quasipneumoniaewgs, Leclercia adecarboxylatag+wgs, Listeria monocytogeneswgs, Mycobacterium aviumwgs, Pseudomonas aeruginosawgs, Salmonella entericag+p+wgs, Serratia marcescenswgs, Shigella boydiig+wgs, Shigella dysenteriaeg+wgs, Shigella flexnerig+wgs, Shigella sonneig+wgs, Streptococcus suiswgs, Vibrio parahaemolyticuswgs
Classification9 ontology terms | Show
Parent Term(s)2 ontology terms | Show
Publications

Lomovskaya O, et al. 1992. Proc. Natl. Acad. Sci. U.S.A. 89(19):8938-42 Emr, an Escherichia coli locus for multidrug resistance. (PMID 1409590)

Resistomes

Prevalence of emrB among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 263 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Acinetobacter baumannii0%0%0.06%0%
Burkholderia cepacia0%0%0.45%0%
Citrobacter amalonaticus100%0%87.5%0%
Citrobacter freundii81.54%0%60.25%0%
Citrobacter koseri100%0%46.67%0%
Citrobacter portucalensis100%0%86%0%
Citrobacter werkmanii71.43%0%100%0%
Citrobacter youngae100%0%100%0%
Cronobacter sakazakii100%0%93.13%0%
Enterobacter asburiae100%0%87.5%0%
Enterobacter chengduensis100%0%90.91%0%
Enterobacter cloacae97.73%0.74%80%0%
Enterobacter hormaechei98.81%0.17%80.12%0%
Enterobacter kobei91.67%0%86.07%0%
Enterobacter roggenkampii96.15%0%73.94%0%
Escherichia albertii90%0%94.25%0%
Escherichia coli61.15%0.02%74.49%0%
Escherichia fergusonii100%0%44.62%0%
Escherichia marmotae100%0%64.29%0%
Klebsiella pneumoniae0.09%0%0.29%0%
Klebsiella quasipneumoniae0%0%0.36%0%
Leclercia adecarboxylata100%0%90.48%0%
Listeria monocytogenes0%0%0.03%0%
Mycobacterium avium0%0%0.48%0%
Pseudomonas aeruginosa0%0%0.05%0%
Salmonella enterica94.22%0.07%89.18%0%
Serratia marcescens0%0%0.15%0%
Shigella boydii100%0%95.7%0%
Shigella dysenteriae90.91%0%96.43%0%
Shigella flexneri100%0%83.5%0%
Shigella sonnei100%0%95.93%0%
Streptococcus suis0%0%0.06%0%
Vibrio parahaemolyticus0%0%0.06%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 900


>gb|AAC75733.1|+|emrB [Escherichia coli str. K-12 substr. MG1655]
MQQQKPLEGAQLVIMTIALSLATFMQVLDSTIANVAIPTIAGNLGSSLSQGTWVITSFGVANAISIPLTGWLAKRVGEVKLFLWSTIAFA
IASWACGVSSSLNMLIFFRVIQGIVAGPLIPLSQSLLLNNYPPAKRSIALALWSMTVIVAPICGPILGGYISDNYHWGWIFFINVPIGVA
VVLMTLQTLRGRETRTERRRIDAVGLALLVIGIGSLQIMLDRGKELDWFSSQEIIILTVVAVVAICFLIVWELTDDNPIVDLSLFKSRNF
TIGCLCISLAYMLYFGAIVLLPQLLQEVYGYTATWAGLASAPVGIIPVILSPIIGRFAHKLDMRRLVTFSFIMYAVCFYWRAYTFEPGMD
FGASAWPQFIQGFAVACFFMPLTTITLSGLPPERLAAASSLSNFTRTLAGSIGTSITTTMWTNRESMHHAQLTESVNPFNPNAQAMYSQL
EGLGMTQQQASGWIAQQITNQGLIISANEIFWMSAGIFLVLLGLVWFAKPPFGAGGGGGGAH


>gb|U00096.1|+|2812616-2814154|emrB [Escherichia coli str. K-12 substr. MG1655]
ATGCAACAGCAAAAACCGCTGGAAGGCGCGCAACTGGTCATTATGACGATTGCGCTGTCACTGGCGACATTCATGCAGGTGCTGGACTCC
ACCATTGCTAACGTGGCGATCCCCACTATCGCCGGGAATCTGGGCTCATCGCTCAGCCAGGGAACGTGGGTAATCACTTCTTTCGGGGTG
GCGAATGCCATCTCGATCCCGCTTACCGGCTGGCTGGCAAAGCGCGTCGGGGAAGTGAAACTGTTCCTTTGGTCCACCATCGCCTTTGCT
ATTGCGTCGTGGGCGTGTGGTGTCTCCAGCAGCCTGAATATGCTGATCTTCTTCCGCGTGATTCAGGGGATTGTCGCCGGGCCGTTGATC
CCGCTTTCGCAAAGTCTATTGCTGAATAACTACCCGCCAGCCAAACGCTCGATCGCGCTGGCGTTGTGGTCGATGACGGTGATTGTCGCG
CCAATTTGCGGCCCGATCCTCGGCGGTTATATCAGCGATAATTACCACTGGGGCTGGATATTCTTCATCAACGTGCCGATTGGCGTGGCG
GTGGTGTTGATGACACTGCAAACTCTGCGCGGACGTGAAACCCGCACCGAACGGCGGCGGATTGATGCCGTGGGGCTGGCACTGCTGGTT
ATTGGTATCGGCAGCCTGCAGATTATGCTCGACCGCGGTAAAGAGCTGGACTGGTTTTCATCACAGGAAATTATCATCCTTACCGTGGTG
GCGGTGGTGGCTATCTGCTTCCTGATTGTCTGGGAGCTGACCGACGATAACCCGATAGTCGATCTGTCGTTGTTTAAGTCGCGCAACTTC
ACCATCGGCTGCTTGTGTATCAGCCTCGCGTATATGCTCTACTTCGGCGCTATTGTTCTGCTGCCGCAGTTGTTGCAGGAGGTCTACGGT
TACACGGCGACCTGGGCAGGTTTGGCCTCTGCGCCGGTAGGGATTATTCCGGTGATCCTGTCGCCGATTATCGGCCGCTTCGCGCATAAA
CTGGATATGCGGCGGCTGGTAACCTTCAGCTTTATTATGTATGCCGTCTGCTTCTACTGGCGTGCCTATACCTTTGAACCAGGTATGGAT
TTTGGCGCGTCGGCCTGGCCGCAGTTTATCCAGGGGTTTGCGGTGGCCTGCTTCTTTATGCCGCTGACCACCATTACGCTGTCTGGTTTG
CCACCGGAACGACTGGCGGCGGCATCGAGCCTCTCTAACTTTACGCGAACGCTGGCGGGGTCTATCGGCACGTCGATAACCACGACCATG
TGGACCAACCGCGAGTCGATGCACCATGCGCAGTTGACTGAGTCGGTAAACCCGTTCAACCCGAATGCCCAGGCGATGTACAGTCAACTG
GAAGGGCTTGGGATGACGCAACAGCAGGCATCAGGCTGGATTGCCCAGCAGATCACCAATCAGGGGCTGATTATTTCCGCCAATGAGATC
TTCTGGATGTCAGCCGGGATATTCCTCGTCCTGCTGGGGCTGGTGTGGTTTGCTAAACCGCCATTTGGCGCAGGTGGCGGCGGAGGCGGT
GCGCACTAA