BRP(MBL)

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3001205
Synonym(s)ble blmA blmS BRP
CARD Short NameBRP(MBL)
DefinitionA novel bleomycin resistance protein encoded by a metallo-beta-lactamase-associated ble gene. Expression of BRP(MBL) confers resistance to bleomycin and bleomycin-like antibiotics in Enterobacteriaceae and Acinetobacter, where it is co-expressed with an MBL and controlled by the same promoter region.
AMR Gene FamilyBleomycin resistant protein
Drug Classpeptide antibiotic, nonribosomal peptide antibiotics, glycopeptide antibiotic
Resistance Mechanismantibiotic inactivation
Classification11 ontology terms | Show
Parent Term(s)5 ontology terms | Show
+ confers_resistance_to_antibiotic bleomycinic acid [Antibiotic]
+ confers_resistance_to_antibiotic bleomycin A2 [Antibiotic]
+ confers_resistance_to_antibiotic bleomycin B2 [Antibiotic]
+ participates_in antibiotic inactivation by sequestration
+ Bleomycin resistant protein [AMR Gene Family]
Resistomes with Perfect MatchesAcinetobacter baumanniiwgs, Acinetobacter haemolyticuswgs, Acinetobacter indicuswgs, Acinetobacter johnsoniiwgs, Acinetobacter juniiwgs, Acinetobacter lwoffiiwgs, Acinetobacter nosocomialiswgs, Acinetobacter pittiiwgs, Acinetobacter radioresistenswgs, Acinetobacter towneriwgs, Aeromonas caviaewgs, Aeromonas veroniiwgs, Citrobacter amalonaticuswgs, Citrobacter freundiip+wgs, Citrobacter koserip+wgs, Citrobacter portucalensiswgs, Citrobacter werkmaniiwgs, Citrobacter youngaep, Enterobacter asburiaep+wgs, Enterobacter chengduensiswgs, Enterobacter cloacaeg+p+wgs, Enterobacter hormaecheip+wgs, Enterobacter kobeip+wgs, Enterobacter roggenkampiiwgs, Escherichia colig+p+wgs, Escherichia fergusoniip, Klebsiella aerogenesp+wgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocawgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Leclercia adecarboxylatawgs, Morganella morganiig+p+wgs, Proteus mirabilisp+wgs, Proteus penneriwgs, Proteus vulgarisp, Providencia rettgeriwgs, Providencia stuartiiwgs, Pseudomonas aeruginosawgs, Pseudomonas putidawgs, Salmonella entericag+p+wgs, Serratia marcescensp+wgs, Shigella sonneiwgs, Vibrio alginolyticuswgs, Vibrio fluvialisg, Vibrio parahaemolyticuswgs, Vibrio vulnificuswgs
Resistomes with Sequence VariantsAcinetobacter baumanniiwgs, Acinetobacter haemolyticuswgs, Acinetobacter indicuswgs, Acinetobacter johnsoniiwgs, Acinetobacter juniiwgs, Acinetobacter lwoffiiwgs, Acinetobacter nosocomialiswgs, Acinetobacter pittiiwgs, Acinetobacter radioresistenswgs, Acinetobacter towneriwgs, Aeromonas caviaewgs, Aeromonas veroniiwgs, Bordetella trematumg, Citrobacter amalonaticuswgs, Citrobacter freundiip+wgs, Citrobacter koserip+wgs, Citrobacter portucalensiswgs, Citrobacter werkmaniiwgs, Citrobacter youngaep, Comamonas testosteroniwgs, Enterobacter asburiaep+wgs, Enterobacter chengduensiswgs, Enterobacter cloacaeg+p+wgs, Enterobacter hormaecheip+wgs, Enterobacter kobeip+wgs, Enterobacter roggenkampiiwgs, Escherichia colig+p+wgs, Escherichia fergusoniip, Klebsiella aerogenesp+wgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocawgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Leclercia adecarboxylatawgs, Morganella morganiig+p+wgs, Proteus mirabilisp+wgs, Proteus penneriwgs, Proteus vulgarisp, Providencia rettgeriwgs, Providencia stuartiiwgs, Pseudomonas aeruginosap+wgs, Pseudomonas putidawgs, Salmonella entericag+p+wgs, Serratia marcescensp+wgs, Shigella sonneiwgs, Stenotrophomonas maltophiliag, Vibrio alginolyticuswgs, Vibrio fluvialisg, Vibrio parahaemolyticuswgs, Vibrio vulnificuswgs
Publications

Dortet L, et al. 2012. Antimicrob Agents Chemother 56(4): 1693-1697. Association of the emerging carbapenemase NDM-1 with a bleomycin resistance protein in Enterobacteriaceae and Acinetobacter baumannii. (PMID 22290943)

Mori T, et al. 2008. Appl Environ Microbiol 74(21): 6803-6805. Metagenomic screening for bleomycin resistance genes. (PMID 18791008)

Resistomes

Prevalence of BRP(MBL) among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii0%0%4.73%0%0%
Acinetobacter haemolyticus0%0%2.33%0%0%
Acinetobacter indicus0%0%1.3%0%0%
Acinetobacter johnsonii0%0%5.45%0%0%
Acinetobacter junii0%0%4.48%0%0%
Acinetobacter lwoffii0%0%5.26%0%0%
Acinetobacter nosocomialis0%0%2.3%0%0%
Acinetobacter pittii0%0%6.25%0%0%
Acinetobacter radioresistens0%0%1.75%0%0%
Acinetobacter towneri0%0%3.85%0%0%
Aeromonas caviae0%0%8.06%0%0%
Aeromonas veronii0%0%0.56%0%0%
Bordetella trematum20%0%0%0%0%
Citrobacter amalonaticus0%0%10.91%0%0%
Citrobacter freundii0%1.54%6.19%0%0%
Citrobacter koseri0%5%0.9%0%0%
Citrobacter portucalensis0%0%9.01%0%0%
Citrobacter werkmanii0%0%35.9%0%0%
Citrobacter youngae0%9.09%0%0%0%
Comamonas testosteroni0%0%7.14%0%0%
Enterobacter asburiae0%0.28%5.53%0%0%
Enterobacter chengduensis0%0%16%0%0%
Enterobacter cloacae1.79%1.68%3.51%0%0%
Enterobacter hormaechei0%1.93%10.92%0%0%
Enterobacter kobei0%1.38%3.49%0%0%
Enterobacter roggenkampii0%0%10.07%0%0%
Escherichia coli0.02%0.47%4.3%0%0%
Escherichia fergusonii0%0.36%0%0%0%
Klebsiella aerogenes0%3.26%1.41%0%0%
Klebsiella michiganensis0%4.57%4.26%0%0%
Klebsiella oxytoca0%0%2.52%0%0%
Klebsiella pneumoniae0.53%1.58%7.14%0%0%
Klebsiella quasipneumoniae0%1.27%7.24%0%0%
Leclercia adecarboxylata0%0%37.21%0%0%
Morganella morganii1.92%2.5%2.45%0%0%
Proteus mirabilis0%2.5%3.96%0%0%
Proteus penneri0%0%12.5%0%0%
Proteus vulgaris0%11.11%0%0%0%
Providencia rettgeri0%0%17.83%0%0%
Providencia stuartii0%0%15.91%0%0%
Pseudomonas aeruginosa0%2.34%0.51%0%0%
Pseudomonas putida0%0%0.53%0%0%
Salmonella enterica0.13%0.16%0.03%0%0%
Serratia marcescens0%2.58%1.31%0%0%
Shigella sonnei0%0%0.07%0%0%
Stenotrophomonas maltophilia1.12%0%0%0%0%
Vibrio alginolyticus0%0%3.97%0%0%
Vibrio fluvialis2.63%0%0%0%0%
Vibrio parahaemolyticus0%0%0.1%0%0%
Vibrio vulnificus0%0%2.04%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 200


>gb|AGH88989.1|+|BRP(MBL) [Acinetobacter baumannii]
MADHVTPNLPSRDFDVTEAFYAKLGFATSWKDRGWMILQRGGLQLEFFPYPDLDPATSSFGCCLRLDDLDAMVALVNAAGAEEKSTGWPR
FKAPQLEASGLRIGYLIDPDCTLVRLIQNPD


>gb|KC503911.1|+|9884-10249|BRP(MBL) [Acinetobacter baumannii]
ATGGCTGACCACGTCACCCCCAATCTGCCATCGCGCGATTTCGATGTGACAGAGGCGTTTTATGCGAAGCTGGGCTTTGCGACGAGTTGG
AAGGATCGCGGCTGGATGATCCTGCAGCGCGGCGGTTTGCAGCTCGAATTCTTCCCCTATCCTGACCTCGACCCAGCTACGAGCTCGTTC
GGCTGTTGCCTGCGGTTGGATGATCTCGATGCCATGGTGGCATTGGTGAACGCGGCGGGAGCCGAGGAAAAAAGCACCGGCTGGCCGCGC
TTCAAAGCTCCGCAACTGGAGGCGAGCGGCCTGAGGATCGGCTACCTGATCGATCCCGACTGCACGCTGGTGCGGCTGATCCAGAACCCC
GACTGA

Curator Acknowledgements
Curator Description Most Recent Edit