catB2

Accession ARO:3002675
DefinitioncatB2 is a plasmid-encoded variant of the cat gene found in Escherichia coli, Salmonella enteritidis and Pasteurella multocida
AMR Gene Familychloramphenicol acetyltransferase (CAT)
Drug Classphenicol antibiotic
Resistance Mechanismantibiotic inactivation
Classification9 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ chloramphenicol acetyltransferase (CAT) [AMR Gene Family]
+ confers_resistance_to_antibiotic azidamfenicol [Antibiotic]
+ confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
+ confers_resistance_to_antibiotic thiamphenicol [Antibiotic]
Publications

Villa L, et al. 2002. J Clin Microbiol 40(7): 2662-2665. Multidrug and broad-spectrum cephalosporin resistance among Salmonella enterica serotype enteritidis clinical isolates in southern Italy. (PMID 12089302)

Tennstedt T, et al. 2003. FEMS Microbiol Ecol 45(3): 239-252. Occurrence of integron-associated resistance gene cassettes located on antibiotic resistance plasmids isolated from a wastewater treatment plant. (PMID 19719593)

Parent R and Roy PH. 1992. J Bacteriol 174(9): 2891-2897. The chloramphenicol acetyltransferase gene of Tn2424: a new breed of cat. (PMID 1314803)

Resistomes

Prevalence of catB2 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Citrobacter freundii0%0%6.98%
Enterobacter cloacae0%0%0.23%
Enterobacter hormaechei0%0.9%1.11%
Morganella morganii0%0%2.38%
Proteus mirabilis0%0%2.59%
Proteus vulgaris0%0%25%
Providencia rettgeri0%0%15.38%
Salmonella enterica0%0%0.03%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 400


>gb|AAP15294.1|-|catB2 [Pasteurella multocida]
MTNYFESPFKGKLLTEQVKNPNIKVGRYSYYSGYYHGHSFDDCARYLLPDRDDVDQLIIGSFCSIGSGAAFIMAGNQGHRYDWVSSFPFF
YMNEEPAFAKSVDAFQRAGDTVIGSDVWIGSEAMIMPGIKIGHGAVIGSRALVTKDVEPYTIVGGNPAKSIRKRFSEEEISMLLDMAWWD
WPLEQIKEAMPFLCSSGIASLYRRWQGTSA


>gb|AY232670.1|-|3525-4157|catB2 [Pasteurella multocida]
ATGACGAATTATTTTGAGAGTCCCTTCAAAGGGAAGCTTCTGACTGAGCAGGTGAAGAATCCGAACATCAAGGTAGGGCGGTATAGCTAC
TATTCCGGCTATTACCATGGGCACTCGTTTGATGATTGTGCTCGCTACCTTCTACCAGACCGTGATGACGTTGATCAGCTGATTATCGGC
AGCTTCTGCTCCATCGGATCAGGCGCAGCTTTTATTATGGCTGGGAATCAAGGCCACCGATATGATTGGGTCTCTTCTTTCCCTTTCTTC
TACATGAACGAGGAGCCCGCGTTTGCAAAATCAGTCGATGCATTCCAGCGGGCTGGCGACACAGTTATAGGAAGTGATGTGTGGATCGGT
TCGGAGGCCATGATCATGCCCGGGATCAAGATCGGGCATGGAGCGGTGATAGGTAGCCGCGCTTTGGTTACCAAAGACGTGGAACCCTAC
ACCATAGTGGGGGGAAACCCTGCAAAGTCGATTAGGAAGCGCTTTTCTGAAGAAGAAATTTCTATGCTTTTAGATATGGCTTGGTGGGAT
TGGCCGCTGGAACAAATCAAGGAAGCAATGCCTTTTCTTTGTTCGTCTGGCATTGCCAGCCTGTATCGTCGCTGGCAAGGCACAAGCGCC
TAA