catB2

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002675
CARD Short NamecatB2
DefinitioncatB2 is a plasmid-encoded variant of the cat gene found in Escherichia coli, Salmonella enteritidis and Pasteurella multocida.
AMR Gene Familychloramphenicol acetyltransferase (CAT)
Drug Classphenicol antibiotic
Resistance Mechanismantibiotic inactivation
Classification8 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ chloramphenicol acetyltransferase (CAT) [AMR Gene Family]
+ confers_resistance_to_antibiotic azidamfenicol [Antibiotic]
+ confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
+ confers_resistance_to_antibiotic thiamphenicol [Antibiotic]
Resistomes with Sequence VariantsAcinetobacter baumanniig+wgs, Citrobacter freundiip+wgs, Citrobacter portucalensiswgs, Enterobacter asburiaewgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter kobeip, Enterobacter roggenkampiiwgs, Escherichia colip+wgs, Klebsiella aerogenesp+wgs, Klebsiella michiganensisg+p, Klebsiella oxytocap, Klebsiella pneumoniaeg+p+wgs+gi, Klebsiella quasipneumoniaep+wgs, Leclercia adecarboxylatag+p, Morganella morganiiwgs, Neisseria brasiliensisg+gi, Proteus mirabiliswgs, Proteus penneriwgs, Proteus vulgariswgs, Providencia heimbachaeg+wgs+gi, Providencia rettgerig+wgs, Pseudomonas aeruginosawgs, Salmonella entericawgs, Serratia marcescenswgs
Publications

Villa L, et al. 2002. J Clin Microbiol 40(7): 2662-2665. Multidrug and broad-spectrum cephalosporin resistance among Salmonella enterica serotype enteritidis clinical isolates in southern Italy. (PMID 12089302)

Tennstedt T, et al. 2003. FEMS Microbiol Ecol 45(3): 239-252. Occurrence of integron-associated resistance gene cassettes located on antibiotic resistance plasmids isolated from a wastewater treatment plant. (PMID 19719593)

Parent R and Roy PH. 1992. J Bacteriol 174(9): 2891-2897. The chloramphenicol acetyltransferase gene of Tn2424: a new breed of cat. (PMID 1314803)

Resistomes

Prevalence of catB2 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii0.18%0%0.14%0%0%
Citrobacter freundii0%0.31%2.9%0%0%
Citrobacter portucalensis0%0%4.5%0%0%
Enterobacter asburiae0%0%1.19%0%0%
Enterobacter cloacae0%0.56%0.96%0%0%
Enterobacter hormaechei0%0.13%1.08%0%0%
Enterobacter kobei0%0.69%0%0%0%
Enterobacter roggenkampii0%0%1.8%0%0%
Escherichia coli0%0.03%0.04%0%0%
Klebsiella aerogenes0%1.09%0.28%0%0%
Klebsiella michiganensis1.61%0.57%0%0%0%
Klebsiella oxytoca0%0.68%0%0%0%
Klebsiella pneumoniae0.06%0.09%0.3%0.95%0%
Klebsiella quasipneumoniae0%0.21%0.39%0%0%
Leclercia adecarboxylata7.14%4.76%0%0%0%
Morganella morganii0%0%3.07%0%0%
Neisseria brasiliensis100%0%0%50%0%
Proteus mirabilis0%0%1.16%0%0%
Proteus penneri0%0%12.5%0%0%
Proteus vulgaris0%0%11.11%0%0%
Providencia heimbachae50%0%14.29%100%0%
Providencia rettgeri5.88%0%1.91%0%0%
Pseudomonas aeruginosa0%0%0.03%0%0%
Salmonella enterica0%0%0.01%0%0%
Serratia marcescens0%0%0.79%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400


>gb|AAP15294.1|-|catB2 [Pasteurella multocida]
MTNYFESPFKGKLLTEQVKNPNIKVGRYSYYSGYYHGHSFDDCARYLLPDRDDVDQLIIGSFCSIGSGAAFIMAGNQGHRYDWVSSFPFF
YMNEEPAFAKSVDAFQRAGDTVIGSDVWIGSEAMIMPGIKIGHGAVIGSRALVTKDVEPYTIVGGNPAKSIRKRFSEEEISMLLDMAWWD
WPLEQIKEAMPFLCSSGIASLYRRWQGTSA


>gb|AY232670.1|-|3525-4157|catB2 [Pasteurella multocida]
ATGACGAATTATTTTGAGAGTCCCTTCAAAGGGAAGCTTCTGACTGAGCAGGTGAAGAATCCGAACATCAAGGTAGGGCGGTATAGCTAC
TATTCCGGCTATTACCATGGGCACTCGTTTGATGATTGTGCTCGCTACCTTCTACCAGACCGTGATGACGTTGATCAGCTGATTATCGGC
AGCTTCTGCTCCATCGGATCAGGCGCAGCTTTTATTATGGCTGGGAATCAAGGCCACCGATATGATTGGGTCTCTTCTTTCCCTTTCTTC
TACATGAACGAGGAGCCCGCGTTTGCAAAATCAGTCGATGCATTCCAGCGGGCTGGCGACACAGTTATAGGAAGTGATGTGTGGATCGGT
TCGGAGGCCATGATCATGCCCGGGATCAAGATCGGGCATGGAGCGGTGATAGGTAGCCGCGCTTTGGTTACCAAAGACGTGGAACCCTAC
ACCATAGTGGGGGGAAACCCTGCAAAGTCGATTAGGAAGCGCTTTTCTGAAGAAGAAATTTCTATGCTTTTAGATATGGCTTGGTGGGAT
TGGCCGCTGGAACAAATCAAGGAAGCAATGCCTTTTCTTTGTTCGTCTGGCATTGCCAGCCTGTATCGTCGCTGGCAAGGCACAAGCGCC
TAA

Curator Acknowledgements
Curator Description Most Recent Edit