catB3

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002676
Synonym(s)catB4
CARD Short NamecatB3
DefinitioncatB3 is a plasmid or chromosome-encoded variant of the cat gene found in Salmonella typhimurium, Acinetobacter baumannii and Escherichia coli.
AMR Gene Familychloramphenicol acetyltransferase (CAT)
Drug Classphenicol antibiotic
Resistance Mechanismantibiotic inactivation
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONEscherichia coli (2), Pseudomonas aeruginosa (2), Serratia marcescens (2)
GAZ
FOODONBos taurus (2)
ENVO
UBERON
Classification8 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ chloramphenicol acetyltransferase (CAT) [AMR Gene Family]
+ confers_resistance_to_antibiotic azidamfenicol [Antibiotic]
+ confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
+ confers_resistance_to_antibiotic thiamphenicol [Antibiotic]
Resistomes with Perfect MatchesAcinetobacter baumanniig+p+wgs, Acinetobacter pittiip+wgs, Acinetobacter townerig, Aeromonas caviaeg+p+wgs+gi, Aeromonas hydrophilag+p+wgs, Aeromonas veroniig+wgs, Alcaligenes faecalisg+wgs+gi, Citrobacter amalonaticusp+wgs, Citrobacter freundiig+p+wgs, Citrobacter koserip+wgs, Citrobacter portucalensisp+wgs, Citrobacter werkmaniiwgs, Citrobacter youngaewgs, Comamonas testosteronip+wgs, Enterobacter asburiaep+wgs, Enterobacter chengduensiswgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeip+wgs, Enterobacter roggenkampiiwgs, Escherichia colig+p+wgs+gi, Escherichia fergusoniip+wgs, Klebsiella aerogenesp+wgs, Klebsiella huaxiensisg+gi, Klebsiella michiganensisp+wgs, Klebsiella oxytocag+p+wgs, Klebsiella pneumoniaeg+p+wgs+gi, Klebsiella quasipneumoniaep+wgs, Leclercia adecarboxylatap, Morganella morganiig+p+wgs+gi, Proteus mirabilisg+p+wgs+gi, Proteus penneriwgs, Providencia alcalifaciensg, Providencia rettgerig+wgs, Providencia stuartiiwgs, Pseudomonas aeruginosap+wgs, Raoultella planticolap+wgs, Salmonella entericag+p+wgs+gi, Serratia marcescensp+wgs, Shigella flexnerip+wgs, Shigella sonneiwgs, Solilutibacter oculig+gi, Vibrio choleraep+wgs
Resistomes with Sequence VariantsAchromobacter xylosoxidansg+wgs, Acinetobacter baumanniig+p+wgs, Acinetobacter johnsoniiwgs, Acinetobacter pittiip+wgs, Acinetobacter townerig, Acinetobacter wuhouensisp, Aeromonas caviaeg+p+wgs+gi, Aeromonas hydrophilag+p+wgs, Aeromonas veroniig+p+wgs, Alcaligenes faecalisg+wgs+gi, Burkholderia cenocepaciawgs, Citrobacter amalonaticusp+wgs, Citrobacter freundiig+p+wgs, Citrobacter koserip+wgs, Citrobacter portucalensisp+wgs, Citrobacter werkmaniiwgs, Citrobacter youngaewgs, Comamonas testosteronip+wgs, Enterobacter asburiaep+wgs, Enterobacter chengduensiswgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheig+p+wgs+gi, Enterobacter kobeip+wgs, Enterobacter roggenkampiiwgs, Escherichia colig+p+wgs+gi, Escherichia fergusoniip+wgs, Klebsiella aerogenesp+wgs, Klebsiella huaxiensisg+gi, Klebsiella michiganensisp+wgs, Klebsiella oxytocag+p+wgs, Klebsiella pneumoniaeg+p+wgs+gi, Klebsiella quasipneumoniaep+wgs, Leclercia adecarboxylatap, Morganella morganiig+p+wgs+gi, Proteus mirabilisg+p+wgs+gi, Proteus penneriwgs, Providencia alcalifaciensg, Providencia rettgerig+wgs, Providencia stuartiiwgs, Pseudomonas aeruginosap+wgs, Pseudomonas putidag, Raoultella planticolap+wgs, Salmonella entericag+p+wgs+gi, Serratia marcescensp+wgs, Shigella flexnerip+wgs, Shigella sonneiwgs, Solilutibacter oculig+gi, Vibrio choleraep+wgs
Publications

Wang M, et al. 2003. Antimicrob Agents Chemother 47(7): 2242-2248. Plasmid-mediated quinolone resistance in clinical isolates of Escherichia coli from Shanghai, China. (PMID 12821475)

Tosini F, et al. 1998. Antimicrob Agents Chemother 42(12): 3053-3058. Class 1 integron-borne multiple-antibiotic resistance carried by IncFI and IncL/M plasmids in Salmonella enterica serotype typhimurium. (PMID 9835490)

Bunny KL, et al. 1995. Antimicrob Agents Chemother 39(3): 686-693. New mobile gene cassettes containing an aminoglycoside resistance gene, aacA7, and a chloramphenicol resistance gene, catB3, in an integron in pBWH301. (PMID 7793874)

Houang ET, et al. 2003. Antimicrob Agents Chemother 47(4): 1382-1390. Epidemiology of rifampin ADP-ribosyltransferase (arr-2) and metallo-beta-lactamase (blaIMP-4) gene cassettes in class 1 integrons in Acinetobacter strains isolated from blood cultures in 1997 to 2000. (PMID 12654674)

Resistomes

Prevalence of catB3 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Achromobacter xylosoxidans82.61%0%88.55%0%0%
Acinetobacter baumannii0.18%0.05%0.45%0%0%
Acinetobacter johnsonii0%0%1.82%0%0%
Acinetobacter pittii0%0.49%0.28%0%0%
Acinetobacter towneri12.5%0%0%0%0%
Acinetobacter wuhouensis0%4.55%0%0%0%
Aeromonas caviae18.18%7.79%18.28%33.33%0%
Aeromonas hydrophila3.08%3.9%2.42%0%0%
Aeromonas veronii5.45%1.54%2.81%0%0%
Alcaligenes faecalis10%0%2.94%33.33%0%
Burkholderia cenocepacia0%0%0.22%0%0%
Citrobacter amalonaticus0%8.33%10.91%0%0%
Citrobacter freundii1.64%8.62%18.76%0%0%
Citrobacter koseri0%15%4.5%0%0%
Citrobacter portucalensis0%14.71%20.72%0%0%
Citrobacter werkmanii0%0%5.13%0%0%
Citrobacter youngae0%0%6.25%0%0%
Comamonas testosteroni0%50%7.14%0%0%
Enterobacter asburiae0%0.55%1.98%0%0%
Enterobacter chengduensis0%0%4%0%0%
Enterobacter cloacae0%1.68%4.79%0%0%
Enterobacter hormaechei0.72%1.35%6.52%6.67%0%
Enterobacter kobei0%2.07%0.87%0%0%
Enterobacter roggenkampii0%0%1.08%0%0%
Escherichia coli0.31%0.35%1.84%1.28%0.09%
Escherichia fergusonii0%0.71%1.09%0%0%
Klebsiella aerogenes0%4.35%0.85%0%0%
Klebsiella huaxiensis100%0%0%50%0%
Klebsiella michiganensis0%9.14%5.32%0%0%
Klebsiella oxytoca2.56%3.42%1.68%0%0%
Klebsiella pneumoniae0.36%0.98%2.44%5.71%0%
Klebsiella quasipneumoniae0%0.85%2.89%0%0%
Leclercia adecarboxylata0%4.76%0%0%0%
Morganella morganii21.15%12.5%19.02%15.38%0%
Proteus mirabilis27.52%6.25%16.67%22.22%0%
Proteus penneri0%0%25%0%0%
Providencia alcalifaciens9.09%0%0%0%0%
Providencia rettgeri2.94%0%1.27%0%0%
Providencia stuartii0%0%11.36%0%0%
Pseudomonas aeruginosa0%2.63%0.93%0%0%
Pseudomonas putida1.41%0%0%0%0%
Raoultella planticola0%6.98%15.38%0%0%
Salmonella enterica0.95%3.12%1.74%2.65%0%
Serratia marcescens0%0.65%0.26%0%0%
Shigella flexneri0%1.2%0.31%0%0%
Shigella sonnei0%0%0.07%0%0%
Solilutibacter oculi100%0%0%50%0%
Vibrio cholerae0%5.26%0.32%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 350


>gb|AFQ93498.1|+|catB3 [Enterobacter cloacae]
MTNYFDSPFKGKLLSEQVKNPNIKVGRYSYYSGYYHGHSFDDCARYLFPDRDDVDKLIIGSFCSIGSGASFIMAGNQGHRYDWASSFPFF
YMQEEPAFSSALDAFQKAGNTVIGNDVWIGSEAMVMPGIKIGHGAVIGSRSLVTKDVEPYAIVGGNPAKKIKKRFTDEEISLLLEMEWWN
WSLEKIKAAMPMLCSSNIVGLHKYWLEFAV


>gb|JX101693.1|+|58201-58833|catB3 [Enterobacter cloacae]
ATGACCAACTACTTTGATAGCCCCTTCAAAGGCAAGCTGCTTTCTGAGCAAGTGAAGAACCCCAATATCAAAGTTGGGCGGTACAGCTAT
TACTCTGGCTACTATCATGGGCACTCATTCGATGACTGCGCACGGTATCTGTTTCCGGACCGTGATGACGTTGATAAGTTGATCATCGGT
AGTTTCTGCTCTATCGGGAGTGGGGCTTCCTTTATCATGGCTGGCAATCAGGGGCATCGGTACGACTGGGCATCATCTTTCCCGTTCTTT
TATATGCAGGAAGAACCTGCATTCTCAAGCGCACTCGATGCCTTCCAAAAAGCAGGTAATACTGTCATTGGCAATGACGTTTGGATCGGC
TCTGAGGCAATGGTCATGCCCGGAATCAAGATCGGGCACGGTGCGGTGATAGGCAGCCGCTCGTTGGTGACAAAAGATGTGGAGCCTTAC
GCTATCGTTGGCGGCAATCCCGCTAAGAAGATTAAGAAACGCTTCACCGATGAGGAAATTTCATTGCTTCTGGAGATGGAGTGGTGGAAT
TGGTCACTGGAGAAGATCAAAGCGGCAATGCCCATGCTGTGCTCGTCTAATATTGTTGGCCTGCACAAGTATTGGCTCGAGTTTGCCGTC
TAA

Curator Acknowledgements
Curator Description Most Recent Edit