Pseudomonas aeruginosa catB6

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002678
CARD Short NamePaer_catB6
DefinitioncatB6 is a plasmid-encoded variant of the cat gene found in Pseudomonas aeruginosa.
AMR Gene Familychloramphenicol acetyltransferase (CAT)
Drug Classphenicol antibiotic
Resistance Mechanismantibiotic inactivation
Classification8 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ chloramphenicol acetyltransferase (CAT) [AMR Gene Family]
+ confers_resistance_to_antibiotic azidamfenicol [Antibiotic]
+ confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
+ confers_resistance_to_antibiotic thiamphenicol [Antibiotic]
Resistomes with Perfect MatchesAeromonas caviaeg, Aeromonas hydrophilawgs, Enterobacter cloacaewgs, Klebsiella pneumoniaewgs, Klebsiella quasipneumoniaep+wgs
Resistomes with Sequence VariantsAeromonas caviaeg, Aeromonas hydrophilawgs, Enterobacter cloacaewgs, Klebsiella pneumoniaewgs, Klebsiella quasipneumoniaep+wgs
Publications

Laraki N, et al. 1999. Antimicrob Agents Chemother 43(4): 890-901. Structure of In31, a blaIMP-containing Pseudomonas aeruginosa integron phyletically related to In5, which carries an unusual array of gene cassettes. (PMID 10103196)

Resistomes

Prevalence of Pseudomonas aeruginosa catB6 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Aeromonas caviae2.27%0%0%0%0%
Aeromonas hydrophila0%0%0.81%0%0%
Enterobacter cloacae0%0%0.32%0%0%
Escherichia coli0%0%0%0%0%
Klebsiella pneumoniae0%0%0.01%0%0%
Klebsiella quasipneumoniae0%1.06%0.13%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400


>gb|CAA11473.1|+|Pseudomonas aeruginosa catB6 [Pseudomonas aeruginosa]
MENYFDSPFKGKLLSEQVTNRNIKVGRYSYYSGYYHGHSFDDCARYLLPDRDDVDKLIIGSFCSIGSGASFIMAGNQGHRHDWVTSFPFF
YMQEEPAFSSSTDAFQKAGDTIVGNDVWIGSEAMIMPGIKIGDGAVIGSRSLVTRDVEPYTIIGGNPAKQIKKRFSDEEISLLMEMEWWN
WPLDKIKTAMPLLCSSDIFGLHRHWRGIAV


>gb|AJ223604.1|+|3018-3650|Pseudomonas aeruginosa catB6 [Pseudomonas aeruginosa]
ATGGAAAATTACTTTGACAGTCCCTTCAAAGGGAAACTACTTTCAGAGCAAGTGACTAACCGCAACATCAAAGTTGGTCGGTACAGCTAC
TACTCTGGTTACTATCACGGGCATTCATTTGATGACTGCGCACGATACTTGCTCCCAGACCGTGATGACGTTGACAAACTAATCATCGGC
AGCTTTTGCTCCATCGGAAGCGGGGCTTCTTTCATCATGGCGGGCAATCAGGGTCACCGGCATGACTGGGTAACATCTTTCCCTTTCTTC
TACATGCAAGAAGAGCCAGCTTTTTCAAGTTCAACGGACGCCTTTCAAAAGGCCGGTGACACCATCGTCGGCAATGATGTCTGGATAGGA
TCAGAGGCAATGATTATGCCCGGCATCAAGATTGGAGATGGCGCGGTAATAGGCAGCCGATCGTTGGTGACGAGAGATGTAGAACCCTAT
ACCATCATTGGCGGAAACCCTGCAAAGCAAATTAAAAAGCGATTCTCTGACGAGGAGATTTCATTACTCATGGAAATGGAGTGGTGGAAC
TGGCCGTTAGATAAAATCAAAACAGCTATGCCCCTTCTCTGCTCTTCAGACATTTTTGGTCTGCACAGGCATTGGCGTGGGATTGCCGTC
TAA

Curator Acknowledgements
Curator Description Most Recent Edit