catB8

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002680
CARD Short NamecatB8
DefinitioncatB8 is a plasmid or integron-encoded variant of the cat gene found in Klebsiella pneumoniae, Salmonella typhi and Pseudomonas aeruginosa.
AMR Gene Familychloramphenicol acetyltransferase (CAT)
Drug Classphenicol antibiotic
Resistance Mechanismantibiotic inactivation
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONAcinetobacter baumannii (4)
GAZ
FOODON
ENVO
UBERON
Classification8 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ chloramphenicol acetyltransferase (CAT) [AMR Gene Family]
+ confers_resistance_to_antibiotic azidamfenicol [Antibiotic]
+ confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
+ confers_resistance_to_antibiotic thiamphenicol [Antibiotic]
Resistomes with Perfect MatchesAcinetobacter baumanniig+p+wgs+gi, Aeromonas caviaep+wgs, Escherichia coliwgs, Klebsiella michiganensiswgs, Klebsiella pneumoniaewgs, Klebsiella quasipneumoniaewgs, Providencia rettgerig
Resistomes with Sequence VariantsAcinetobacter baumanniig+p+wgs+gi, Acinetobacter juniiwgs, Acinetobacter pittiiwgs, Aeromonas caviaeg+p+wgs, Enterobacter asburiaewgs, Enterobacter cloacaep, Enterobacter hormaecheiwgs, Enterobacter kobeiwgs, Escherichia coliwgs, Faucicola osloensisgi, Klebsiella michiganensiswgs, Klebsiella pneumoniaewgs, Klebsiella quasipneumoniaewgs, Morganella morganiig+wgs, Proteus mirabiliswgs, Proteus vulgarisp, Providencia heimbachaep, Providencia rettgerig+p+wgs, Pseudomonas aeruginosap+wgs, Shigella sonneiwgs
Publications

Pai H, et al. 2003. Antimicrob Agents Chemother 47(6): 2006-2008. Salmonella enterica serovar typhi strains isolated in Korea containing a multidrug resistance class 1 integron. (PMID 12760886)

Resistomes

Prevalence of catB8 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii21.42%0.21%15.67%13.21%0%
Acinetobacter junii0%0%2.99%0%0%
Acinetobacter pittii0%0%0.28%0%0%
Aeromonas caviae2.27%2.6%15.59%0%0%
Enterobacter asburiae0%0%0.79%0%0%
Enterobacter cloacae0%0.56%0%0%0%
Enterobacter hormaechei0%0%0.65%0%0%
Enterobacter kobei0%0%1.31%0%0%
Escherichia coli0%0%0.02%0%0%
Faucicola osloensis0%0%0%33.33%0%
Klebsiella michiganensis0%0%1.06%0%0%
Klebsiella pneumoniae0%0%0.04%0%0%
Klebsiella quasipneumoniae0%0%0.39%0%0%
Morganella morganii3.85%0%3.07%0%0%
Proteus mirabilis0%0%1.16%0%0%
Proteus vulgaris0%11.11%0%0%0%
Providencia heimbachae0%100%0%0%0%
Providencia rettgeri2.94%5.41%3.18%0%0%
Pseudomonas aeruginosa0%0.29%0.07%0%0%
Shigella sonnei0%0%0.07%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400


>gb|AAM92461.1|+|catB8 [Salmonella enterica subsp. enterica serovar Typhi]
MKNYFNSPFKGELLSEQVKNPNIRVGRYSYYSGYYHGHSFDECARYLLPDRDDVDKLIIGSFCSIGSGASFIMAGNQGHRHDWASSFPFF
YMQEEPAFSRALDAFQRAGDTVIGNDVWIGSEAMIMPGIKIGDGAVIGSRSLVTKDVEPYAIIGGNPAKQIKKRFSDEEISLLMEMEWWN
WPLDKIKTAMPLLCSSNIFGLHKYWREFAV


>gb|AY123251.1|+|812-1444|catB8 [Salmonella enterica subsp. enterica serovar Typhi]
ATGAAAAACTACTTTAACAGCCCTTTCAAAGGGGAACTTCTTTCTGAGCAAGTGAAAAATCCAAATATCAGAGTAGGCCGGTATAGCTAT
TACTCTGGCTACTATCACGGGCACTCATTTGATGAATGCGCGCGATACTTGCTTCCAGATCGTGATGACGTTGATAAATTGATCATTGGC
AGCTTTTGTTCTATAGGAAGCGGGGCTTCCTTCATCATGGCTGGCAATCAGGGGCATCGGCATGACTGGGCATCATCCTTCCCCTTCTTC
TATATGCAAGAGGAGCCTGCTTTCTCAAGAGCACTCGACGCCTTCCAAAGAGCAGGTGATACCGTCATTGGCAATGATGTCTGGATAGGC
TCGGAGGCAATGATTATGCCTGGCATCAAAATTGGAGACGGTGCCGTGATAGGTAGTCGCTCGTTGGTGACAAAAGATGTAGAGCCTTAT
GCCATCATCGGGGGAAATCCCGCAAAGCAAATTAAGAAGCGCTTCTCCGATGAGGAAATCTCATTGCTCATGGAGATGGAGTGGTGGAAC
TGGCCACTAGATAAAATTAAGACAGCAATGCCTCTGCTGTGCTCGTCAAATATTTTTGGTCTGCATAAGTATTGGCGCGAGTTTGCCGTC
TAA

Curator Acknowledgements
Curator Description Most Recent Edit