catB9

Accession ARO:3002681
DefinitioncatB9 is a chromosome-encoded variant of the cat gene found in Vibrio cholerae
AMR Gene Familychloramphenicol acetyltransferase (CAT)
Drug Classphenicol antibiotic
Resistance Mechanismantibiotic inactivation
ResistomesVibrio choleraeg+wgs
Classification9 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ chloramphenicol acetyltransferase (CAT) [AMR Gene Family]
+ confers_resistance_to_antibiotic azidamfenicol [Antibiotic]
+ confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
+ confers_resistance_to_antibiotic thiamphenicol [Antibiotic]
Publications

Heidelberg JF, et al. 2000. Nature 406(6795): 477-483. DNA sequence of both chromosomes of the cholera pathogen Vibrio cholerae. (PMID 10952301)

Rowe-Magnus DA, et al. 2002. Mol Microbiol 43(6): 1657-1669. Bacterial resistance evolution by recruitment of super-integron gene cassettes. (PMID 11952913)

Resistomes

Prevalence of catB9 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Vibrio cholerae31.76%0%59.96%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 400


>gb|AAL68645.1|+|catB9 [Vibrio cholerae]
MNFFTSPFSGIPLDQQVTNPNIIVGKHSYYSGYYHGHSFDDCVRYLHPERDDVDKLVIGSFCSIGSGAVFMMAGNQGHRSDWISTFPFFY
QDNDNFADARDGFTRSGDTIIGHDVWIGTEAMIMPGVKIGHGAIIASRSVVTKDVAPYEVVGSNPAKHIKFRFSDVEIAMLLEMAWWNWP
ESWLKESMQSLCSSDIEGLYLNWQSKART


>gb|AF462019|+|27-656|catB9 [Vibrio cholerae]
ATGAACTTCTTTACGTCTCCATTTTCTGGGATTCCCTTAGATCAGCAAGTAACAAATCCGAACATTATTGTGGGAAAACACAGTTATTAT
TCTGGTTATTATCACGGGCACAGTTTCGATGATTGTGTGCGATATTTACATCCAGAAAGAGATGACGTTGATAAGTTAGTCATAGGGAGT
TTTTGTTCTATAGGCTCTGGTGCTGTATTTATGATGGCCGGTAATCAAGGGCATCGCAGTGATTGGATAAGTACATTCCCATTTTTCTAT
CAGGATAATGATAATTTTGCAGATGCACGCGATGGTTTTACGCGTTCAGGAGACACAATTATTGGTCATGATGTGTGGATTGGCACTGAG
GCTATGATAATGCCTGGGGTTAAAATTGGACATGGAGCGATAATCGCCAGTCGTTCAGTAGTGACTAAGGATGTTGCACCTTATGAAGTG
GTCGGTTCAAATCCTGCTAAACATATCAAGTTTAGATTTTCTGATGTGGAAATAGCGATGTTACTTGAAATGGCATGGTGGAATTGGCCA
GAATCGTGGTTGAAAGAGAGTATGCAGTCTCTGTGTTCATCAGACATTGAAGGGCTTTATCTCAATTGGCAGTCAAAAGCACGCACATAA