catI

Accession ARO:3002683
DefinitioncatI is a chromosome and transposon-encoded variant of the cat gene found in Escherichia coli and Acinetobacter baumannii
AMR Gene Familychloramphenicol acetyltransferase (CAT)
Drug Classphenicol antibiotic
Resistance Mechanismantibiotic inactivation
ResistomesAcinetobacter baumanniig+wgs, Citrobacter freundiig+p+wgs, Citrobacter koseriwgs, Clostridioides difficileg, Enterobacter asburiaewgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheiwgs, Enterococcus faecaliswgs, Escherichia colig+p+wgs, Helicobacter pylorig, Klebsiella aerogeneswgs, Klebsiella oxytocawgs, Klebsiella pneumoniaeg+p+wgs, Morganella morganiig+wgs, Neisseria gonorrhoeaep+wgs, Proteus mirabilisg+wgs, Proteus vulgariswgs, Pseudomonas aeruginosawgs, Salmonella entericag+p+wgs, Serratia marcescenswgs, Shigella dysenteriaep+wgs, Shigella flexnerip+wgs, Shigella sonneiwgs, Vibrio choleraep, Vibrio parahaemolyticuswgs
Classification9 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ chloramphenicol acetyltransferase (CAT) [AMR Gene Family]
+ confers_resistance_to_drug azidamfenicol [Antibiotic]
+ confers_resistance_to_drug chloramphenicol [Antibiotic]
+ confers_resistance_to_drug thiamphenicol [Antibiotic]
Publications

Alton NK and Vapnek D. 1979. Nature 282(5741): 864-869. Nucleotide sequence analysis of the chloramphenicol resistance transposon Tn9. (PMID 390403)

Elisha BG, et al. 1991. Plasmid 25(2): 96-104. Identification of an Acinetobacter baumannii gene region with sequence and organizational similarity to Tn2670. (PMID 1650008)

Resistomes

Prevalence of catI among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Acinetobacter baumannii5.65%0%1.85%
Citrobacter freundii4.55%3.77%5.83%
Citrobacter koseri0%0%9.09%
Clostridioides difficile1.54%0%0%
Enterobacter asburiae0%0%3.33%
Enterobacter cloacae2.5%3.37%8.32%
Enterobacter hormaechei0%0%19.23%
Enterobacter kobei0%0%5.88%
Enterococcus faecalis0%0%0.27%
Enterococcus faecium0%0%0%
Escherichia coli4.01%1.29%5.41%
Helicobacter pylori4.03%0%0%
Klebsiella aerogenes0%0%0.56%
Klebsiella oxytoca0%0%15.45%
Klebsiella pneumoniae0.65%5.16%22.05%
Legionella pneumophila0%0%0.38%
Morganella morganii11.11%0%12.5%
Neisseria gonorrhoeae0%4.17%0.19%
Proteus mirabilis13.64%0%12.64%
Proteus vulgaris0%0%10%
Pseudomonas aeruginosa0%0%0.09%
Salmonella enterica5.08%6.24%9.82%
Serratia marcescens0%3.03%0.9%
Shigella dysenteriae0%25%22.73%
Shigella flexneri0%14.29%77.27%
Shigella sonnei0%8.33%6.98%
Vibrio cholerae0%9.09%0%
Vibrio parahaemolyticus0%0%0.25%
Yersinia pestis0%0%0.3%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 400


>gb|CAA23899.1|+|catI [Escherichia coli]
MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFLKTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHP
CYTVFHEQTETFSSLWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANMDNFFAPVFTMGKYYTQG
DKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA


>gb|V00622|+|244-903|catI [Escherichia coli]
ATGGAGAAAAAAATCACTGGATATACCACCGTTGATATATCCCAATGGCATCGTAAAGAACATTTTGAGGCATTTCAGTCAGTTGCTCAA
TGTACCTATAACCAGACCGTTCAGCTGGATATTACGGCCTTTTTAAAGACCGTAAAGAAAAATAAGCACAAGTTTTATCCGGCCTTTATT
CACATTCTTGCCCGCCTGATGAATGCTCATCCGGAATTCCGTATGGCAATGAAAGACGGTGAGCTGGTGATATGGGATAGTGTTCACCCT
TGTTACACCGTTTTCCATGAGCAAACTGAAACGTTTTCATCGCTCTGGAGTGAATACCACGACGATTTCCGGCAGTTTCTACACATATAT
TCGCAAGATGTGGCGTGTTACGGTGAAAACCTGGCCTATTTCCCTAAAGGGTTTATTGAGAATATGTTTTTCGTCTCAGCCAATCCCTGG
GTGAGTTTCACCAGTTTTGATTTAAACGTGGCCAATATGGACAACTTCTTCGCCCCCGTTTTCACCATGGGCAAATATTATACGCAAGGC
GACAAGGTGCTGATGCCGCTGGCGATTCAGGTTCATCATGCCGTCTGTGATGGCTTCCATGTCGGCAGAATGCTTAATGAATTACAACAG
TACTGCGATGAGTGGCAGGGCGGGGCGTAA