catI

Accession ARO:3002683
CARD Short NamecatI
DefinitioncatI is a chromosome and transposon-encoded variant of the cat gene found in Escherichia coli and Acinetobacter baumannii.
AMR Gene Familychloramphenicol acetyltransferase (CAT)
Drug Classphenicol antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesAcinetobacter baumanniig+wgs+gi, Alcaligenes faecaliswgs, Chlamydia trachomatisg, Citrobacter freundiig+p+wgs, Citrobacter koseriwgs, Citrobacter portucalensiswgs, Citrobacter werkmaniiwgs, Clostridioides difficileg, Comamonas testosteroniwgs, Cronobacter sakazakiiwgs, Cupriavidus metalliduranswgs, Enterobacter asburiaep+wgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiiwgs, Enterococcus faecaliswgs, Escherichia albertiig, Escherichia colig+p+wgs+gi, Escherichia fergusoniip+wgs, Helicobacter pylorig, Klebsiella aerogeneswgs, Klebsiella michiganensisg+p+wgs, Klebsiella oxytocawgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaewgs, Leclercia adecarboxylatawgs, Morganella morganiig+wgs, Neisseria gonorrhoeaewgs, Proteus mirabilisg+wgs+gi, Proteus vulgariswgs, Providencia rettgeriwgs, Pseudomonas aeruginosawgs, Salmonella entericag+p+wgs+gi, Serratia marcescensg+wgs, Shigella boydiiwgs, Shigella dysenteriaeg+p+wgs+gi, Shigella flexnerig+wgs+gi, Shigella sonneiwgs, Vibrio choleraep, Vibrio parahaemolyticuswgs
Resistomes with Sequence VariantsAcinetobacter baumanniig+p+wgs+gi, Aeromonas hydrophilawgs, Aeromonas veroniiwgs, Alcaligenes faecaliswgs, Bacillus cereuswgs, Campylobacter jejuniwgs, Chlamydia trachomatisg, Citrobacter freundiig+p+wgs, Citrobacter koseriwgs, Citrobacter portucalensiswgs, Citrobacter werkmaniiwgs, Clostridioides difficileg, Comamonas testosteroniwgs, Cronobacter sakazakiiwgs, Cupriavidus metalliduranswgs, Enterobacter asburiaep+wgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiiwgs, Enterococcus faecaliswgs, Escherichia albertiig, Escherichia colig+p+wgs+gi, Escherichia fergusoniip+wgs, Helicobacter pylorig, Klebsiella aerogeneswgs, Klebsiella michiganensisg+p+wgs, Klebsiella oxytocawgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaewgs, Leclercia adecarboxylatawgs, Legionella pneumophilawgs, Morganella morganiig+wgs, Neisseria gonorrhoeaewgs, Proteus mirabilisg+wgs+gi, Proteus vulgariswgs, Providencia rettgeriwgs, Pseudomonas aeruginosawgs, Pseudomonas putidawgs, Salmonella entericag+p+wgs+gi, Serratia marcescensg+wgs, Shigella boydiiwgs, Shigella dysenteriaeg+p+wgs+gi, Shigella flexnerig+wgs+gi, Shigella sonneiwgs, Staphylococcus aureuswgs, Vibrio choleraep+wgs, Vibrio parahaemolyticuswgs, Yersinia pestiswgs
Classification8 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ chloramphenicol acetyltransferase (CAT) [AMR Gene Family]
+ confers_resistance_to_antibiotic azidamfenicol [Antibiotic]
+ confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
+ confers_resistance_to_antibiotic thiamphenicol [Antibiotic]
Publications

Alton NK and Vapnek D. 1979. Nature 282(5741): 864-869. Nucleotide sequence analysis of the chloramphenicol resistance transposon Tn9. (PMID 390403)

Elisha BG, et al. 1991. Plasmid 25(2): 96-104. Identification of an Acinetobacter baumannii gene region with sequence and organizational similarity to Tn2670. (PMID 1650008)

Resistomes

Prevalence of catI among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 263 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Acinetobacter baumannii3.12%0.06%1.94%2.52%
Aeromonas hydrophila0%0%1.06%0%
Aeromonas veronii0%0%0.79%0%
Alcaligenes faecalis0%0%4.35%0%
Bacillus cereus0%0%0.18%0%
Campylobacter jejuni0%0%0.06%0%
Chlamydia trachomatis18.18%0%0%0%
Citrobacter freundii3.85%1.82%5.06%0%
Citrobacter koseri0%0%1.11%0%
Citrobacter portucalensis0%0%8%0%
Citrobacter werkmanii0%0%23.81%0%
Clostridioides difficile0.39%0%0%0%
Comamonas testosteroni0%0%6.67%0%
Cronobacter sakazakii0%0%0.51%0%
Cupriavidus metallidurans0%0%12.5%0%
Enterobacter asburiae0%1.14%2.78%0%
Enterobacter cloacae0%3.68%6.82%0%
Enterobacter hormaechei0%2.55%8.61%0%
Enterobacter kobei0%0%7.38%0%
Enterobacter roggenkampii0%0%4.24%0%
Enterococcus faecalis0%0%0.11%0%
Escherichia albertii5%0%0%0%
Escherichia coli2.2%0.49%5.13%0.64%
Escherichia fergusonii0%0.4%1.54%0%
Helicobacter pylori1.47%0%0%0%
Klebsiella aerogenes0%0%0.31%0%
Klebsiella michiganensis6.98%0.8%0.97%0%
Klebsiella oxytoca0%0%10.6%0%
Klebsiella pneumoniae0.84%2.44%14.29%0%
Klebsiella quasipneumoniae0%0%8.6%0%
Leclercia adecarboxylata0%0%9.52%0%
Legionella pneumophila0%0%0.26%0%
Morganella morganii20.41%0%10.42%0%
Neisseria gonorrhoeae0%0%0.14%0%
Proteus mirabilis18.75%0%12.76%3.7%
Proteus vulgaris0%0%6.67%0%
Providencia rettgeri0%0%1.72%0%
Pseudomonas aeruginosa0%0%0.05%0%
Pseudomonas putida0%0%0.76%0%
Salmonella enterica2.28%2.29%4.34%7.95%
Serratia marcescens0.92%0%1.36%0%
Shigella boydii0%0%7.53%0%
Shigella dysenteriae9.09%16.67%32.14%25%
Shigella flexneri42.11%0%70.92%16.67%
Shigella sonnei0%0%7.55%0%
Staphylococcus aureus0%0%0.02%0%
Vibrio cholerae0%6.25%0.07%0%
Vibrio parahaemolyticus0%0%0.13%0%
Yersinia pestis0%0%0.2%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 400


>gb|CAA23899.1|+|catI [Escherichia coli]
MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFLKTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHP
CYTVFHEQTETFSSLWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANMDNFFAPVFTMGKYYTQG
DKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA


>gb|V00622.1|+|244-903|catI [Escherichia coli]
ATGGAGAAAAAAATCACTGGATATACCACCGTTGATATATCCCAATGGCATCGTAAAGAACATTTTGAGGCATTTCAGTCAGTTGCTCAA
TGTACCTATAACCAGACCGTTCAGCTGGATATTACGGCCTTTTTAAAGACCGTAAAGAAAAATAAGCACAAGTTTTATCCGGCCTTTATT
CACATTCTTGCCCGCCTGATGAATGCTCATCCGGAATTCCGTATGGCAATGAAAGACGGTGAGCTGGTGATATGGGATAGTGTTCACCCT
TGTTACACCGTTTTCCATGAGCAAACTGAAACGTTTTCATCGCTCTGGAGTGAATACCACGACGATTTCCGGCAGTTTCTACACATATAT
TCGCAAGATGTGGCGTGTTACGGTGAAAACCTGGCCTATTTCCCTAAAGGGTTTATTGAGAATATGTTTTTCGTCTCAGCCAATCCCTGG
GTGAGTTTCACCAGTTTTGATTTAAACGTGGCCAATATGGACAACTTCTTCGCCCCCGTTTTCACCATGGGCAAATATTATACGCAAGGC
GACAAGGTGCTGATGCCGCTGGCGATTCAGGTTCATCATGCCGTCTGTGATGGCTTCCATGTCGGCAGAATGCTTAATGAATTACAACAG
TACTGCGATGAGTGGCAGGGCGGGGCGTAA