catIII

Accession ARO:3002685
Synonym(s)catA3
CARD Short NamecatIII
DefinitioncatIII is a plasmid-encoded variant of the cat gene found in Shigella flexneri.
AMR Gene Familychloramphenicol acetyltransferase (CAT)
Drug Classphenicol antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesEscherichia coliwgs, Klebsiella pneumoniaewgs, Providencia stuartiig+wgs, Vibrio choleraewgs, Vibrio parahaemolyticuswgs
Resistomes with Sequence VariantsActinobacillus indolicusg+gi, Avibacterium paragallinarumwgs, Escherichia colip+wgs, Glaesserella parasuisg+wgs, Klebsiella pneumoniaewgs, Pasteurella multocidag+wgs+gi, Providencia stuartiig+wgs, Vibrio choleraewgs, Vibrio parahaemolyticuswgs
Classification8 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ chloramphenicol acetyltransferase (CAT) [AMR Gene Family]
+ confers_resistance_to_antibiotic azidamfenicol [Antibiotic]
+ confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
+ confers_resistance_to_antibiotic thiamphenicol [Antibiotic]
Publications

Murray IA, et al. 1988. Biochem J 252(1): 173-179. Nucleotide sequence analysis and overexpression of the gene encoding a type III chloramphenicol acetyltransferase. (PMID 3048245)

Resistomes

Prevalence of catIII among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 263 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Actinobacillus indolicus100%0%0%100%
Avibacterium paragallinarum0%0%2.94%0%
Escherichia coli0%0.01%0.01%0%
Glaesserella parasuis9.09%0%4.17%0%
Klebsiella pneumoniae0%0%0.02%0%
Pasteurella multocida2.25%0%0.53%16.67%
Providencia stuartii100%0%58.14%0%
Vibrio cholerae0%0%0.07%0%
Vibrio parahaemolyticus0%0%0.06%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 400


>gb|CAA30695.1|+|catIII [Plasmid R387]
MNYTKFDVKNWVRREHFEFYRHRLPCGFSLTSKIDITTLKKSLDDSAYKFYPVMIYLIAQAVNQFDELRMAIKDDELIVWDSVDPQFTVF
HQETETFSALSCPYSSDIDQFMVNYLSVMERYKSDTKLFPQGVTPENHLNISALPWVNFDSFNLNVANFTDYFAPIITMAKYQQEGDRLL
LPLSVQVHHAVCDGFHVARFINRLQELCNSKLK


>gb|X07848.1|+|272-913|catIII [Plasmid R387]
ATGAACTATACAAAATTTGATGTAAAAAATTGGGTTCGCCGTGAGCATTTTGAGTTTTATCGGCATCGTTTACCATGTGGTTTTAGCTTA
ACAAGCAAAATTGATATCACGACGTTAAAAAAGTCATTGGATGATTCAGCGTATAAGTTTTATCCGGTAATGATCTATCTGATTGCTCAG
GCCGTGAATCAATTTGATGAGTTGAGAATGGCGATAAAAGATGATGAATTGATCGTATGGGATTCAGTCGACCCACAATTCACCGTATTC
CATCAAGAAACAGAGACATTTTCAGCACTGAGTTGCCCATACTCATCCGATATTGATCAATTTATGGTGAATTATTTATCGGTAATGGAA
CGTTATAAAAGTGATACCAAGTTATTTCCTCAAGGGGTAACACCAGAAAATCATTTAAATATTTCAGCATTACCTTGGGTTAATTTTGAT
AGCTTTAATTTAAATGTTGCTAATTTTACCGATTATTTTGCACCCATTATAACAATGGCAAAATATCAGCAAGAAGGGGATAGACTGTTA
TTGCCGCTCTCAGTACAGGTTCATCATGCAGTTTGTGATGGCTTCCATGTTGCACGCTTTATTAATCGGCTACAAGAGTTGTGTAACAGT
AAATTAAAATAA